KEGG   Myceliophthora thermophila: MYCTH_76403Help
Entry
MYCTH_76403       CDS       T02231                                 

Definition
histone deacetylase RPD3-like protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MYCTH_76403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(2553824..2554714,2554766..2555307,2555378..2555678,2555767..2555976))
Genome map
AA seq 647 aa AA seqDB search
MPRTTDMSGVERTRPLYTIVNNDKKRVAYFYDSDIGNYAYVTGHPMKPHRIRLAHSLVMN
YDVYKFLEIYRAKPAVTSEMTQFHTDEYIEFLQKVTPDNMDSFMREQGKYNVGDDCPVFD
GLFEFCGISAGGSMEGAARLNREKCDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELL
RFKKRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGIGNGKHYAV
NFPLRDGIDDVTYRTIFEPVIEAVMKYYQPEAVVLQCGGDSLSGDRLGCFNLSMRGHANC
VNFVRSFGLPTLVLGGGGYTMRNVARTWAYETGRLVGVEMDPVLPYNEYYNYYGPDYELD
VRASNMENANSPEYLEKIKIAVIENLKKTAHAPSVQMQDVPRQSMGMTDEQEAELDDRDE
DENPDVRVTQRQWEKRVQRQDEFEESDDEDIARANGVYKANGRSRQETTFRNTTKDDDTM
EIDSGVATPPEPAAEPAADNDDTMIDETMAEASTEAAQTEAPNPDASEKPADTEKAKTDG
DGDIDMTEAAPAEDKEAETAIKREEVEGITAAEAEPAKSPAPESTAKAAEEGEAPATKSR
TSASPEAVGKTEAKPAEETPAVETSGDNAAAAAAAAEKKEDGEEAKA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaccacggatatgtcgggggtcgagcgcacccgaccgctttacaccattgtc
aacaatgacaagaagagggtggcttacttttacgactccgacattggcaactatgcctac
gtgaccggccatccgatgaagccgcaccgtattcgtcttgcgcacagcctggttatgaat
tacgatgtttacaagttcctcgagatctaccgggctaagcctgcagtcacgtcggagatg
acgcagttccacaccgatgaatacatcgaattcttgcagaaagttaccccggacaatatg
gacagcttcatgcgggagcaaggcaaatacaatgtcggcgatgactgcccggtctttgac
ggcctgtttgaattctgcggcatcagcgccggcggcagcatggaaggcgctgctcgtctc
aatcgcgaaaagtgtgacattgcaatcaactgggccggcggtctgcatcacgccaagaag
agcgaagccagcgggttctgctacgtgaatgatattgtgctcgccattctcgagttactc
cgtttcaagaaacgcgtgctctacgtcgacattgatgttcaccatggcgatggcgtcgag
gaagctttctacacgaccgaccgtgtcatgacagtctcgttccacaagtatggcgaatac
ttccccggcaccggtgagctccgcgatatcggcattggcaatggcaagcactatgctgtc
aactttcccctgagagacggcattgacgacgtcacgtaccggaccatcttcgagcctgtc
atcgaagcggtcatgaaatactatcagcccgaagcagtcgttttgcagtgtggcggcgac
agtctgtccggcgaccgtttgggctgcttcaacctgagcatgcgtggccatgccaactgc
gtcaactttgtccgcagttttggtctgcctactctggtcctcggcggcggtggctacacc
atgcgcaacgttgcccgcacatgggcttacgaaacgggccggctggttggtgtggagatg
gacccggtccttccctacaacgagtattacaactactatgggcctgattacgagctcgat
gtgagggcgtccaacatggagaatgcgaacagtcctgagtacctggagaagatcaagatt
gcggtcatcgagaatctcaagaaaaccgcccatgctccctctgttcagatgcaggatgtc
cctcgccagagcatgggcatgaccgacgagcaggaggctgagcttgatgaccgcgacgag
gatgagaacccggatgtccgcgtgacccagcgccagtgggagaagcgcgtgcaacgccag
gacgagtttgaggagtctgacgatgaggacatcgctcgcgccaatggcgtctacaaggcc
aacggtcgttctcgccaggagaccacgttccgcaacaccactaaagatgacgataccatg
gagattgacagcggtgttgctacccccccggagcctgccgctgaaccggctgccgataac
gacgacaccatgattgacgagacaatggctgaggcatcgaccgaggctgcccagacggag
gcgccgaatcctgatgcctccgagaagcctgcggacaccgagaaggcgaagactgacggt
gatggcgacatcgatatgactgaggctgcccctgctgaggacaaggaagccgaaaccgcc
attaagcgcgaagaggttgagggtatcacggcggctgaggcggagccggccaagagccct
gctccggagagcacggccaaggctgccgaggagggcgaagctcccgccacgaagtctcgc
acctccgcctctccggaggctgtcggcaaaaccgaagccaagccggccgaggagactccg
gctgtcgagacctccggcgacaatgccgccgccgccgccgccgccgccgagaagaaagag
gatggtgaggaggctaaggcctag

DBGET integrated database retrieval system