KEGG   Myceliophthora thermophila: MYCTH_81343Help
Entry
MYCTH_81343       CDS       T02231                                 

Definition
MAP kinase-like protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mtm  Myceliophthora thermophila
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MYCTH_81343
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MYCTH_81343
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   MYCTH_81343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(1299885..1299929,1300148..1300861,1300919..1301580,1301644..1301800)
Genome map
AA seq 525 aa AA seqDB search
MAAPQNQSSDSPAAMPSHPALGIPQHNTSSQVPTMPAAPPLLRPAIPGSRPGRAGPRLGL
AIPPSPNAKPVSNPGAPAQRPALPTLHLATPMGSNVVPQEQTQPLKPSLSLQSASGGSES
SAAHSRSGSFGPLDGRASNPTSAGSQFSALSFASQFGIGRQTGDPVSAVGSLYSNASESM
DMDRDGSLHGLESFDEATLEKARTADVEDLDDDGWRIVSMEKRIIELGNLGEGAGGAVTK
CKLRGGNTVFALKVITTNPDPDAKRQIIRELGFNKGCASQHICRYYGAFVDPATATISIA
MEFCEGGSLDSIYKEVKKLGGRTGEKVLGKIAEGVLHGLTYLHSKKIIHRDIKPSNILLC
RNGDVKLCDFGVSGEFGTKGDASTFIGTSYYMAPERITGQSYTITSDVWSTGITLLEVAQ
HRFPFPADGTEMQPRATPLDLLTYIVKHPTPKLKDEPEANIYWSSNFKYFIDCCLEKEPA
RRASPWRMLEHPWMVEMAAKRVNMRRYLAQVWGWDENEPQASQKA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcctcagaaccagagcagcgacagccctgcagccatgccgtcgcatcctgcc
ctcggaatcccacaacacaacacgtcctcccaagttcccaccatgccggctgcaccacct
ctcctccgacccgccatccccggctcgcgcccgggcagggcggggccccgtctggggctc
gccatccctccgtctccaaacgcaaagccggtcagcaacccaggcgcgcccgcgcagcgt
ccggccctacccaccctgcacctcgcgacccccatgggcagcaacgtggtgccacaagaa
cagacacagccactcaagccctcgctgagcctacagagcgcgagcggcggcagcgagagc
agtgccgcccacagcaggagcgggagctttgggccgctcgacggccgcgcgagcaatccc
acaagtgccggctcccagtttagcgcgctctctttcgcgagtcaattcgggataggaaga
cagaccggtgaccccgtgtcggctgtcggatcgctatattccaatgccagcgagagcatg
gacatggatcgggacggcagcctgcatggcctggaaagcttcgacgaggccaccctcgag
aaggcgaggacggctgatgtggaggatctcgacgacgatggttggcgaatcgtgagcatg
gagaagcggattatcgagctcgggaacctaggcgagggcgctggcggtgccgtgacaaaa
tgcaagttgaggggcggcaacaccgtgtttgctctcaaggtcataaccacgaaccctgac
cccgatgccaagaggcagattattcgcgagttggggttcaataaggggtgtgcctcgcaa
cacatctgccgttactacggcgccttcgtcgaccctgcgacagccaccatctccatcgcc
atggagttctgcgagggcgggtcgctcgacagcatctacaaggaagtgaagaagctcggc
ggtcgcaccggcgagaaagtcctgggcaagatcgctgaaggtgtactccacggcttgacg
tacctgcactccaagaagatcatccaccgcgacatcaagccgagcaacatcctgctttgc
cgcaatggggatgtgaagctctgcgactttggcgtgtcgggcgagttcggcaccaaggga
gatgccagcaccttcatcggtaccagctactacatggcaccggagcgcatcacgggccag
tcgtacaccatcacgtccgacgtctggtccaccggcatcaccctcctcgaggttgcccag
catcgcttcccgttcccggccgatggtacggagatgcagcctcgcgccactcctctcgac
ctgttgacctacatcgtcaaacatccgactcccaagctcaaggacgaacccgaggccaac
atttactggagtagcaacttcaagtatttcatcgattgctgccttgagaaggagccggct
cgccgggccagcccgtggcgaatgctggagcacccctggatggtggaaatggccgcgaaa
cgcgtcaacatgcgccgttatctggcccaagtgtggggatgggacgagaatgaaccacag
gcttcacaaaaggcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system