KEGG   Myceliophthora thermophila: MYCTH_82275Help
Entry
MYCTH_82275       CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCTH_82275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(2648355..2650993,2651152..2651836))
Genome map
AA seq 1107 aa AA seqDB search
MADAQLTEEELQQSVMQSERNAGAVQDNLDGDVEMSNDSPFTSPSHIDVGSGSVDGDGED
EDMGEEEEHKEEYDDNENAAQQDEDHTDSSESEEDDDDGDVFEEDAEGEGDDIPVTQNRR
PQRRSASMANGHDDDEDDEDEGVGAVKIKPGETDDEDDSGVSSASLASSTDAESDEEAEW
EPADNGDADEDDELENTAGLCIFCKQDEEHDPSEEFEVFLACIKCGDNAPETWKCPGCAD
ESDSNSAAESGEEAELNGGTDEGGASAPRRPTAPNLARDLLPPQKGVMKPDSHSVFNQLV
LDEDPMDGSRVLRKRKTSSIEADESIIGLRKRRRNTGDDQSNDGVATGQKDSSRPVSRSL
RLKIPSHSASIVKMTRHSVLVKLRVNPSELRQILSQRPKGQKKRSSRSRRRTSRSESTRA
APLPLSAIATPFTPSAYSQPFYSFYDKETDELKGKPYGGILSEAEADTSKTMPTSEDRRR
FDEAKQKAEEEWRQRLLKMQTEVEAPTKKSRKASGPASQIECIEFGGWEIDTWYAAPYPE
EYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHPPGDEIYRHGSVSVFEVDGRKNPVY
CQNLCLLAKLFLGSKTLYYDVEPFLFYVLCEYDDLGYHFVGYFSKEKRASSQNNVSCILT
LPIHQRKGYGNLLIDFSYLLTRVEKKTGSPEKPLSDMGLVSYRNYWRLVMCRYLLSHFSE
ESSGKAGLSIKQISDDTGLTPDDVISALEGLRCLVRDPQTQLYAFRIDFQYCREYVAKWE
AKKYVQLNEKALTWTPYVMGRSNATNFELGPALTAIAPREEEEEVKSAVATEQPLVNGDQ
STQPDIPAEQTSSNIVPEPAVLQSTEPSEPPQHIEPTEPTGLMEGTHIGTDNAVNGIKLN
GSLTECESAEQKTQPKVELEPRPATTTAGSWMDQYKDVPPTRFEVVPPINGRRTDRTRSF
LPRPPAVRAASASVSRPRPRRSAGSRRSNASSRPRTSNSNSKRKPGGTGRGPGRWPKGTK
KSDYGNASSGPGLPPAWIAERARLAALAAAKKEGKDGADVMDTVQVQSPTVQEGSKMQKG
EGKGNGKDKGKENADVEMQDAEGKVDA
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcgcagctcacggaggaggagttgcagcaaagcgtcatgcagtcggaacga
aacgccggggcggtgcaggacaacctcgatggcgatgtggagatgagcaacgacagtccg
ttcacttccccaagtcatattgacgttggttctgggtctgtggacggagatggggaggac
gaggacatgggtgaagaggaggagcacaaggaggaatacgacgacaatgaaaacgctgcg
caacaagacgaggaccacactgacagtagcgaatcggaagaagacgatgacgacggcgac
gttttcgaagaggatgccgagggagagggggacgatatcccggtaactcaaaaccgccgc
ccacaacgaaggtcagccagcatggcgaacggtcacgatgacgatgaagacgacgaagac
gaaggtgtcggcgcagtcaaaataaagcctggcgagacggatgatgaagatgacagcggc
gtctcctcggcgagcttagctagctccaccgacgccgaatcagacgaggaggcggaatgg
gagcctgccgataatggcgatgctgatgaggatgacgagctcgaaaataccgctggcctt
tgcatcttttgtaagcaggacgaggaacatgatccgagcgaggagttcgaggtattcttg
gcctgcattaagtgtggggataacgctcccgagacatggaaatgccccgggtgtgcagac
gagtcggattcgaacagcgccgctgagtcgggcgaggaggctgagctgaacggaggcact
gatgaagggggagcctccgctcccaggcggcctacggctccaaacctcgcccgtgactta
ctacccccgcaaaagggggtaatgaaacccgactcccactctgttttcaaccagttggtt
ctcgacgaagaccctatggatggatctcgtgtccttaggaagcgcaaaacgtcttcgatc
gaagcggacgaaagtattattggcctacgcaaacggcggagaaacacgggtgatgaccag
agcaacgatggtgtagcaacaggccagaaggactcttccaggccggtctcgagatccttg
cgtttgaagattccaagccactccgcatccatcgtcaagatgacgcgccatagcgttctc
gtcaagttgcgagtaaacccgtcggaactccgccaaatcctgtcccaaaggccaaagggc
cagaagaagcgctcgagccggtcccggaggcgaacgtcgaggagcgaatcgacccgcgcc
gcacctttgcccctgagtgcaattgcaacacccttcacacccagcgcgtactcgcaaccg
ttctattcgttctacgacaaggagacggacgaactaaaagggaaaccttacggcggaatt
ctcagcgaagcggaggctgatacctccaaaactatgccgacaagcgaagatcgtcggcgt
ttcgacgaagcgaagcaaaaagcggaagaggagtggcgacagcgcttgctcaagatgcag
accgaggtcgaggctcccaccaaaaagtcgaggaaggcgtcaggtcctgccagccagatc
gagtgcatcgagtttggcggctgggagattgatacctggtacgcggctccttacccggaa
gagtacagcagaaatcgcgtcctttacatctgcgaattctgtctcaaatatatgaactcg
gactatgtggcttggcgccacaagctcaaatgcccagccaaacaccctccaggagacgag
atttacaggcacggctcagtgtcggtctttgaggtcgacggccgcaagaatccggtgtac
tgtcaaaatctctgtctcctggcgaaattattccttggttctaagaccctgtactacgac
gtggagccattcctcttttacgttctttgcgagtacgacgacttaggttatcactttgtc
gggtatttctccaaagagaagcgcgcaagcagccagaacaatgtctcctgcattcttaca
cttcccattcaccaacgcaaagggtatggaaacctgttgatcgacttctcctacctcttg
accagggtagagaagaagactggttccccggagaagccgctctccgacatgggtttggtt
tcttacaggaactactggcggctggtgatgtgccgttacctcttgtctcacttttccgaa
gagagctcgggcaaggcaggcctgagcatcaaacagatctcggacgacaccggactgacg
ccggacgacgtaatttcggctttggaggggctgaggtgcttggtacgagacccgcaaaca
cagctctacgctttccgcatcgacttccagtactgtcgggaatatgtcgcgaagtgggaa
gcaaagaagtatgtgcagctcaacgaaaaagccctgacatggacgccgtatgtcatgggc
agaagcaacgcgacaaacttcgagctgggtcctgctctgaccgcaattgccccgcgagaa
gaggaagaggaggtaaaatcggctgttgcgacggagcagcctctggttaacggtgatcag
tcgactcagccagacattcctgccgaacagacaagctcaaacattgttcccgagcctgcc
gtgcttcaatccaccgagcccagcgagccaccgcaacatattgaacccactgaacctact
gggctgatggaaggcacacatattggcactgacaacgctgtcaacggcattaaattgaac
ggtagcctcaccgagtgtgaatccgcagaacaaaagacccagccaaaagtcgagctcgag
cctcggccggccacgacgacggcaggcagctggatggaccagtataaagacgtacccccc
acacggtttgaagtggttcccccgatcaacggccgcagaaccgaccgcacaaggtcattc
ctaccccgaccacctgcagtgcgagctgccagcgccagcgtctcccgcccaaggccgaga
cgctcggctggttctcgccgttccaacgcctcgtcaagaccgcggaccagcaatagcaac
agcaaacgcaagccgggcggtacggggcgcgggcccggtcgctggcccaagggcaccaag
aaaagcgactacggcaatgcgtccagcggtccaggcctcccgccagcgtggattgcggaa
cgcgcgagacttgcagcgctggctgcggcgaaaaaagagggcaaagacggcgcagatgtc
atggacactgtgcaggtgcagtcgcctaccgtacaggagggcagcaagatgcaaaaggga
gagggcaaggggaatggcaaggacaagggaaaggagaatgcggatgtggaaatgcaggat
gctgagggcaaggtagatgcgtga

DBGET integrated database retrieval system