KEGG   Myceliophthora thermophila: MYCTH_84590Help
Entry
MYCTH_84590       CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     MYCTH_84590
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   MYCTH_84590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(2934141..2934204,2934298..2935277,2935351..2935499,2935573..2935687))
Genome map
AA seq 435 aa AA seqDB search
MSWKKSERLMETIRHYASFPATGVSLRQMVQFGEKPSAGTLFRASQFLAEELPIRLAHRV
QELETLPDGLNEMPSVKKVADWYAQSFEEITSLPRPELSKDVRERLMRPSRNAGKGTSWL
SEATPNPSIEEGQYNSFNGNGNGKNKFAATRRYFAMVDDTGDWPPELQLYNQKFAQTLRR
VKRRHDSVVTTMAQGILEYKRKRQRMQIDNNIQSFLDRFYMSRIGIRMLIGQHIALTDQS
HHRDPSYVGIICTKTYVRDLAQEAIENARFVCEDHYGLFEAPKIQLVCDPNLNFMYVPGH
LSHMLFETLKNSLRAVVETHGQDKQEFPVTKVIVAEGKEDITIKISDEGGGIPRSAIPLV
WTYMYTTVDRTPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDV
YLHLNRLSSSSEPLQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaaaaagagcgagcgcctgatggagaccatccggcactatgccagcttccca
gcgaccggcgtgagcctgcgccagatggtccagttcggcgagaagccgtctgctgggacc
ctgttccgcgcctcgcagttcctcgccgaggagctgcccatccggctcgcccatcgcgtc
caagagctcgagacgcttccggatggcctgaatgagatgccgtcggtgaagaaggtggcc
gattggtatgcgcagtcgttcgaggaaatcacctcgctacccagaccagagctcagcaaa
gacgtgcgggagagattgatgaggccctcgaggaacgcaggaaagggcacttcatggctg
agtgaggcaacaccgaacccgagcatcgaagagggacagtacaactcgttcaacggcaac
ggcaacggcaagaacaagttcgccgcgacgaggaggtattttgcaatggtggacgacacg
ggcgactggccgcccgagctgcagctgtacaaccagaagttcgctcaaacgctgcgccga
gtcaagcggagacacgacagcgtcgtcaccaccatggcacagggcatcctcgagtacaaa
cgcaaacggcaacggatgcagatcgacaacaacatacagtccttcctggaccgcttctac
atgtctcgcattggaatacgtatgctcatcggccagcacattgctctgacggaccagagc
caccaccgcgatccgtcctatgtcggcatcatctgcaccaagacgtacgtcagggatctg
gcccaggaggccatcgagaacgcgcgcttcgtctgcgaggaccactacggcttgtttgag
gcgcccaagatccagctcgtgtgcgatccaaacctcaacttcatgtatgtgccaggtcac
ctgtcgcacatgctcttcgagacgctcaagaactcgctgcgcgccgtcgtcgagacgcac
ggccaagataaacaagagtttcccgtcaccaaggtgatcgtggccgagggcaaggaggac
atcacgatcaagatctcggacgagggcggcggcatcccgcggagcgccatcccgctggtc
tggacctacatgtacaccaccgtcgaccggacgccgaaccttgacccggactttgacaag
agcgatttcaaggcgcccatggccgggttcggctacggcctccccatatcacgcctgtac
gcgaggtatttcggtggtgatttgaagctcatcagcatggaaggctacggcacggacgtc
tacctccatctgaaccgcctatcaagctcgtcggagccgctgcaatag

DBGET integrated database retrieval system