KEGG   Myceliophthora thermophila: MYCTH_85756Help
Entry
MYCTH_85756       CDS       T02231                                 

Definition
histone acetyltransferase ESA1-like protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCTH_85756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(270744..270829,270897..272310)
Genome map
AA seq 499 aa AA seqDB search
MSPGATNGEAEVGSNEPMQKSKATPDTLKIGCIALVTKDGQPRRAEILSIRETKSGKQFY
CNFDNFNKRLDEWVTVDRIDFDQDVEWPNPDKDKLKDAKNKKTGAVSKKSQPSKKTQKRI
GKREQSVASEGQTPHQWTESADGQNKPDGEDGANASLEVGATPGVGPDEMELDEDETPAS
AAKKEKAQPFSREQEIEKLRTSGSMTQNPAEISRIRNINKVEFGRYVLFPWYFSPYPEAF
SQEDCIYICEFCLSYFGNLKSFTRHRTKCTLQHPPGNEIYRDDFISFFEIDGRRQRTWCR
NLCLLCKMFLDHKTLYYDVDPFLFYVMTSRDEKGSHIIGFFSKEKESADGYNVACILTLP
PYQRKGYGRLLIQFSYELSKIEGKLGSPEKPLSDLGLLSYRQYWAENIIDLLLGYSESGE
KCTIETIATRLAMTTQDVEHTLQALKMQVYHKGEHKIVIPEKLLKQREKSRAKQKRVIDP
SRIQWKPPVFTAANRTWGW
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgggcgctactaacggagaagccgaggtcggatcaaatgaaccaatgcagaag
agcaaggcgacgcccgatacgctcaagatcggatgcatcgccctcgtcaccaaagatggg
caaccacggcgcgccgagatcctcagcataagggaaaccaaaagtggcaagcaattctat
tgcaactttgataacttcaacaagcgattagacgaatgggttacggttgataggatcgac
ttcgatcaggatgttgagtggcccaacccggacaaagacaaactgaaggacgccaagaac
aagaagacgggagcggtatccaaaaagtcacaaccatcgaagaagacgcagaagagaatt
ggcaagcgggagcagtccgtcgcgtcagaaggccagacaccacatcagtggaccgagtct
gccgacgggcaaaacaagccagatggggaagacggagcgaatgcgagcttagaggtcggg
gccacgcccggcgtcggccccgacgagatggaactggacgaggacgagacgccggccagc
gccgccaagaaagaaaaggcgcagccgttcagccgcgagcaggagatcgagaagttgcgg
acctcgggctctatgacgcagaatcccgccgagatttcccgcatccggaacatcaacaag
gtagagttcgggcggtacgtgctctttccttggtacttctcgccatatccagaggccttc
agccaggaggactgcatctatatctgcgagttctgcctgagctacttcggcaacctgaaa
tccttcacgcgacaccgcacaaagtgcacactacaacatccgccggggaacgagatctac
cgggacgatttcatatcatttttcgagattgacggcaggcggcagcggacatggtgccgg
aacctgtgtctcctatgcaagatgtttttggaccacaagacgctttactacgatgtggat
cccttcctcttctatgtcatgacgtctagggacgagaaggggtcgcacatcattggtttc
ttctccaaagagaaagagagtgcggacggatacaacgtggcctgtatcctgacactacca
ccgtaccagcgcaaggggtacggtcggctgctcatccagttctcgtacgagctatccaag
atcgagggcaagctcgggtcgcccgagaagccgctttctgatctgggtctgctgagttac
cggcaatactgggcggagaacatcattgatctgctgcttggatacagcgagagcggggag
aagtgcacgattgagaccattgcaacacggctcgccatgacgacccaggacgtcgagcac
accctgcaggcgctcaagatgcaggtgtaccacaaaggggagcacaaaatcgtgatacca
gagaagctcctgaagcagcgggagaagtcgagagcgaagcagaagcgcgtgatcgacccg
tcgaggatccagtggaaacctccggtcttcactgcggccaacaggacatggggatggtag

DBGET integrated database retrieval system