KEGG   Myceliophthora thermophila: MYCTH_86753Help
Entry
MYCTH_86753       CDS       T02231                                 

Definition
glycoside hydrolase family 5 protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCTH_86753
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MYCTH_86753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(2823649..2824011,2824136..2824880,2825205..2825266)
Genome map
AA seq 389 aa AA seqDB search
MKSSILASVFATGAVAQSGPWQQCGGIGWQGSTDCVSGYHCVYQNDWYSQCVPGAASTTL
QTSTTSRPTATSTAPPSSTTSPSKGKLKWLGSNESGAEFGEGNYPGLWGKHFIFPSTSAI
QTLINDGYNIFRIDFSMERLVPNQLTSSFDQGYLRNLTEVVNFVTNAGKYAVLDPHNYGR
YYGNIITDTNAFRTFWTNLAKQFASNSLVIFDTNNEYNTMDQTLVLNLNQAAIDGIRAAG
ATSQYIFVEGNAWSGAWSWNTTNTNMAALTDPQNKIVYEMHQYLDSDSSGTHAECVSSTI
GAQRVVGATQWLRANGKLGVLGEFAGGANAVCQQAVTGLLDHLQDNSDVWLGALWWAAGP
WWGDYMYSFEPPSGTGYVNYNSILKKYLP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctccatcctcgccagcgtcttcgccacgggcgccgtggctcaaagtggtccg
tggcagcaatgtggtggcatcggatggcaaggatcgaccgactgtgtgtcgggctaccac
tgcgtctaccagaacgattggtacagccagtgcgtgcctggcgcggcgtcgacaacgctg
cagacatcgaccacgtccaggcccaccgccaccagcaccgcccctccgtcgtccaccacc
tcgcctagcaagggcaagctgaagtggctcggcagcaacgagtcgggcgccgagttcggg
gagggcaattaccccggcctctggggcaagcacttcatcttcccgtcgacttcggcgatt
cagacgctcatcaatgatggatacaacatcttccggatcgacttctcgatggagcgtctg
gtgcccaaccagttgacgtcgtccttcgaccagggttacctccgcaacctgaccgaggtg
gtcaacttcgtgacgaacgcgggcaagtacgccgtcctggacccgcacaactacggccgg
tactacggcaacatcatcacggacacgaacgcgttccggaccttctggaccaacctggcc
aagcagttcgcctccaactcgctcgtcatcttcgacaccaacaacgagtacaacacgatg
gaccagaccctggtgctcaacctcaaccaggccgccatcgacggcatccgggccgccggc
gcgacctcgcagtacatcttcgtcgagggcaacgcgtggagcggggcctggagctggaac
acgaccaacaccaacatggccgccctgacggacccgcagaacaagatcgtgtacgagatg
caccagtacctcgactcggacagctcgggcacccacgccgagtgcgtcagcagcaccatc
ggcgcccagcgcgtcgtcggagccacccagtggctccgcgccaacggcaagctcggcgtc
ctcggcgagttcgccggcggcgccaacgccgtctgccagcaggccgtcaccggcctcctc
gaccacctccaggacaacagcgacgtctggctgggtgccctctggtgggccgccggtccc
tggtggggcgactacatgtactcgttcgagcctccttcgggcaccggctatgtcaactac
aactcgatcttgaagaagtacttgccgtaa

DBGET integrated database retrieval system