KEGG   Myceliophthora thermophila: MYCTH_96869Help
Entry
MYCTH_96869       CDS       T02231                                 

Definition
histone deacetylase A-like protein
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MYCTH_96869
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MYCTH_96869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(1546295..1546635,1546744..1546918,1547041..1547133,1547196..1547259,1547313..1548904))
Genome map
AA seq 754 aa AA seqDB search
MDIIENDVVMDGEDRRMTDGSSAPNGFLDVTTTGESSIPDATNGQGTSGMSRDEDQDSDP
TAYPEHLRRRGLLPTGCCYDDRMKLHANADFGPNPHHPEDPSRIEYIMRTFKKNGLVFTG
SDAELIRIIQTEPTKYMWRIPAREATKEEICMVHHPGHFLWVEALSRKSTQELRELSTRM
DQGRDSLYVGSMTYEASLISAGGAIETCKSVVAGVVKNAFAIIRPPGHHAEFDAPMGFCL
FNNVPIAAKICQADYPDLCRKILILDWDVHHGNGIQNLFYDDPNILYISLHVYRNGEFYP
GKPDNPMTPDGGLEHCGAGPGLGKNVNIGWHDQGMGDGEYMAAFQKIVMPIAHEFNPDLV
IISAGFDAAAGDELGACFVTPSCYAHMTHMLMSLAGGKVAVCLEGGYDLEAISKSALAVA
RTLMGEPPPKMEIPKISREAAKVLAKVQAYQAPYWECMRAGIVDVQEMQAQESSRLHDVV
RRAQRQVLSEKHGMLPLYIQRDVLFKSFENQVLVTRGIQSARRILVIVHDPPELHAQPDP
LDNTVEAHNAWVTDGVTRYIDWAIEKGFGVIDVNVPHYITHPEDTDAFIPRADERTLQAQ
VQELMCYIWDNYLQLYDSVEDIFLMGVGNAYLGIKVLLINRLDVKSRVAGVVNFVNGSLR
PVKSDVDSDLSSWYKEHSQVYVANDHACWSDPDLTRKVMKRRFGNVIRAQVNGLTPMMAE
YFADVQQFIMERVTSDEGGRDEGEETEEEESGGR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggacatcatcgagaatgatgtcgtcatggatggtgaggaccgccgcatgactgatggc
tcttcggctcccaacggttttctagatgtaactacgacgggggagagttcaatcccggat
gccaccaacggccaaggcaccagcggcatgagccgggatgaagaccaggactctgacccg
acagcttaccccgagcacctgcggcgacgtggcctgctgccgactggttgctgctacgat
gaccgcatgaagctacatgccaatgccgactttgggcctaacccgcatcacccagaggat
ccgtcgcggatcgagtacatcatgagaaccttcaagaagaatggtctggtgttcactggc
tccgacgccgagctcatccgcattatccagaccgagccaaccaagtacatgtggcgaatc
ccggcgagggaagcaaccaaggaggaaatctgcatggttcaccaccctgggcacttccta
tgggttgaagctctgtcccgtaaatcaacccaagagcttcgcgagctgtccacccggatg
gatcaaggcagggactcgctctatgtcggcagtatgacatacgaggcgtcgctgatctcg
gccggcggcgccatcgagacgtgcaaaagcgtggttgccggcgtcgtgaagaacgcgttc
gccatcatccgcccgccgggccatcacgccgagtttgacgcgcccatggggttctgtctc
tttaacaacgttcccattgctgctaaaatctgccaggccgactacccagacctctgccga
aagattctaatcttggactgggacgtgcaccacggcaacggcatccagaacctcttctac
gacgaccccaatatcctctacatttctctccacgtctaccgcaacggcgagttctacccc
ggcaagcccgataacccgatgacgcccgacggcgggctcgagcactgcggtgccgggccc
ggcctaggcaagaacgtcaacatcggctggcacgaccaggggatgggcgacggtgagtat
atggcggccttccagaagatcgtcatgcccatcgcccacgagttcaacccggacctggtc
atcatctcggccggcttcgacgccgccgccggcgacgagctgggagcctgcttcgtcacg
cccagctgctacgcccacatgacgcacatgctcatgtcgctcgccggcggcaaggtggcg
gtctgtctcgagggcggctacgacctcgaggccatctcgaaatcggcgctggccgtcgcc
cggacgctcatgggggagccgcccccgaagatggagatccccaagatcagccgcgaggcg
gccaaggtgctggccaaggtccaggcgtatcaggcgccgtactgggagtgcatgcgcgcc
ggcatcgtcgacgtccaggagatgcaggcgcaggagtcgtcgcgtctgcacgatgtggtg
cgccgggcgcaacgccaggtcttgtccgagaagcacggcatgctgccgttgtatatccag
cgagacgtactattcaagtctttcgagaaccaggtgctggtgactagggggatccagtca
gctcgcaggatcctggtcatcgtccatgacccgccggaactgcatgcccagcctgatccg
ctggacaacacggtggaggctcacaacgcatgggtgacggacggcgtcacgcgttacatt
gactgggccattgagaaaggcttcggagtcatcgatgtcaacgtgcctcactacatcacg
cacccagaggacactgatgccttcatcccacgcgccgacgaacgcacgctccaagcccaa
gtccaagaactaatgtgctatatctgggacaactacctgcagctgtacgactcggtcgaa
gacatcttcctgatgggcgtaggcaacgcctaccttggaatcaaggtcctgctcatcaat
cgactagacgtcaagtcccgggtcgcgggcgtggtcaacttcgtcaacggcagcctgcga
ccggtcaagtcggacgtggacagcgatctgtcgtcgtggtacaaggagcactcgcaggtg
tacgtggccaacgaccacgcgtgctggtccgacccggacctcacgcgcaaggtgatgaag
cgccggttcggcaacgtcatccgcgcgcaggtcaacggcctcacgccgatgatggcggaa
tatttcgcggacgtgcagcagttcatcatggagagggtgacgtcggacgaaggcgggaga
gacgagggggaagagaccgaagaggaggagagtggggggaggtag

DBGET integrated database retrieval system