KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_0072Help
Entry
ERDMAN_0072       CDS       T02526                                 

Gene name
celA1
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ERDMAN_0072 (celA1)
Enzymes [BR:mtn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ERDMAN_0072 (celA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
65622..66674
Genome map
AA seq 350 aa AA seqDB search
MAFVELRHYFARVMSSAIGSVARWIVPLLGVAAVASIGVIADPVRVVRAPALILVDAANP
LAGKPFYVDPASAAMVAARNANPPNAELTSVANTPQSYWLDQAFPPATVGGTVARYTGAA
QAAGAMPVLTLYGIPHRDCGSYASGGFATGTDYRGWIDAVASGLGSSPATIIVEPDALAM
ADCLSPDQRQERFDLVRYAVDTLTRDPAAAVYVDAGHSRWLSAEAMAARLNDVGVGRARG
FSLNVSNFYTTDEEIGYGEAISGLTNGSHYVIDTSRNGAGPAPDAPLNWCNPSGRALGAP
PTTATAGAHADAYLWIKRPGESDGTCGRGEPQAGRFVSQYAIDLAHNAGQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttggcgtttgtcgaattgcggcattattttgctcgggtgatgtcatcagctattggttcg
gtcgcgcggtggatagtccccctcctgggggttgcagccgttgcttccatcggtgttatc
gcggacccggtgcgggtcgttcgggccccggcgttgatcctggtcgatgcggcaaacccg
ctggccggaaagcccttctacgtcgatcccgcctcggcggccatggtcgccgcgcgcaac
gccaacccgccgaacgccgagctgacctccgtcgccaacaccccgcagtcctactggctc
gaccaggcattcccgccggcgaccgtcggcggcacggttgccaggtacaccggagcggcg
caggcggccggcgccatgccggttctgacgctgtatggaatcccccatcgcgactgcggt
agctacgcatccggtgggttcgcgacgggcactgattaccgcgggtggatcgacgctgtc
gcatccggcctgggctcatcgccggcgacgatcatcgtcgaacccgatgcgctggccatg
gccgactgcctgtcgcctgaccagcgccaggaacgtttcgacttggtgcgctacgccgtc
gacacgctgacccgcgacccggccgctgccgtgtacgtcgatgcggggcattcgcgctgg
ctgagcgccgaggcaatggccgccaggctcaacgatgtcggtgtgggccgcgcgcgcggg
tttagcctcaacgtctcgaacttctacaccaccgatgaggaaatcggctatggcgaggcg
atttcggggctcacgaacggttcgcattacgtgatcgacacgtcgcgcaacggcgccgga
cccgcgcccgacgccccgctcaactggtgtaaccccagcggccgcgccctgggcgcaccg
cccaccacggcgaccgcgggcgcgcacgccgacgcttacctgtggatcaaacgtcccggg
gaatcggacggaacctgcggtcgcggggagcctcaggcgggtcggttcgttagccagtac
gccatcgatctggcccacaacgccggccagtag

DBGET integrated database retrieval system