KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_1045Help
Entry
ERDMAN_1045       CDS       T02526                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051254..1051736
Genome map
AA seq 160 aa AA seqDB search
MLVAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVA
KISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPC
PVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtggccgggacgccgcagccgcgcgcgctcgggcccgatgcgctggacgtcagc
accgacgacctggccgggctgttggccggcaacaccggccggatcaagaccgtcatcacc
gaccagaaggtaattgccggcatcggcaacgcctatagtgacgaaatcctgcacgtcgcg
aagatctcgccgttcgccacggccggcaagttatccggcgcacagctcacctgcctgcat
gaggcgatggcgtcggtgctgtcggacgcggtgcgccggtccgtcggccagggcgcggcc
atgctcaaaggggagaaacgttctgggcttcgagtacatgcgcgcaccgggttaccctgc
ccagtgtgcggtgacaccgtgcgggaggtgtccttcgcggacaagtcttttcagtactgt
ccaacgtgtcagaccggtggcaaggcgctggccgaccggcgtatgtcgcggctgctcaag
tag

DBGET integrated database retrieval system