KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_2681Help
Entry
ERDMAN_2681       CDS       T02526                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ERDMAN_2681 (rbsK)
Enzymes [BR:mtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ERDMAN_2681 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2722247..2723092
Genome map
AA seq 281 aa AA seqDB search
MDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAAARAGAQVQFSGAFGDDPAAAQLR
AHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLVAPGANAHLTPVPSAVANCDVLLT
QLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSLQDLAAIADVVIANEHEANDWPSP
PTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGAGDVFAGVLAANWPRNPGSPAERL
RALRRACAAGALATLVSGAGDCAPAAAAIDAALRANRHNGS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggacctgacgttcgtggtggacgcgcttccgcgccccggcgagacggtgcttgcggcg
tcgttgacccgaacgccaggcgggaagggcgccaaccaggcggtggccgcagcgcgcgca
ggcgcgcaggtacagttctccggtgcattcggcgacgatccagccgccgcccagctgcgg
gcccacctgcgcgccaacgccgttggactggacaggaccgtcacggtgcccggaccgagc
gggacggcgattatcgtggtcgatgccagcgccgagaacaccgtgctggtggcgccgggt
gccaatgcacatctgactccggtaccctcggccgtcgccaactgcgatgtactgttgacc
cagttggagattcctgttgcaaccgcgctggcagccgcgcgggcagcccagtcggccgat
gcggttgtcatggtcaacgcctccccagccggccaggatcgaagctccttgcaggacttg
gccgctatcgccgacgtggtgatcgccaacgagcatgaggcaaacgactggccgtcgcca
ccaacacatttcgtgatcaccctgggtgtgcgcggtgcccggtacgtcggcgcggacggg
gtgttcgaggtacccgccccaacggtaacgccagtggataccgccggcgccggcgacgta
tttgccggggtccttgctgcgaattggccgcgcaacccaggttcgccggccgagcgactg
cgcgcattgcggcgggcctgcgctgcgggtgcgctggcaactttggtgtccggtgccggc
gactgcgcaccggccgccgccgcgatcgatgcggccctgcgagccaaccgccacaacggt
tcatga

DBGET integrated database retrieval system