KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_2939Help
Entry
ERDMAN_2939       CDS       T02526                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  
protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ERDMAN_2939 (hemY)
Enzymes [BR:mtn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ERDMAN_2939 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     ERDMAN_2939 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2979573..2980886)
Genome map
AA seq 437 aa AA seqDB search
MTSAYRLRQAVGDDATITLFEPADRLGGVLRTEHIGGQPMDLGAEAFVLRRPEMPALLAE
LGLSDRQLASTGARPLIYSQQRLHPLPPQTVVGIPSSAGSMAGLVDDATLARIDAEAARP
FTWQVGSDPAVADLVADRFGDQVVARSVDPLLSGVYAGSAATIGLRAAAPSVAAALDRGA
TSVTDAVRQALPPGSGGPVFGALDGGYQVLLDGLVRRSRVHWVRARVVQLERGWVLRDET
GGRWQADAVILAVPAPRLARLVDGIAPRTHAAARQIVSASSAVVALAVPGGTAFPHCSGV
LVAGDESPHAKAITLSSRKWGQRGDVALLRLSFGRFGDEPALTASDDQLLAWAADDLVTV
FGVAVDPVDVRVRRWIEAMPQYGPGHADVVAELRAGLPPTLAVAGSYLDGIGVPACVGAA
GRAVTSVIEALDAQVAR
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgacctcggcgtaccggctgcggcaggctgtcggcgatgacgcgaccatcaccttgttc
gaaccggccgataggctcggcggggtattgcgcaccgagcatatcggcggacagccaatg
gacctcggcgcggaggcgttcgtgctgcgtaggcccgagatgccggcgcttttggccgag
ctgggcctgtcggaccgccaactcgccagcaccggcgcgcggccgctcatctacagccag
cagcgcttgcacccgctgccgccgcagacggtcgtcgggatcccgtcgtcggcgggctcc
atggcggggctggtcgacgacgcaaccctggcgcggatcgacgccgaagccgctcgtccg
ttcacctggcaggtgggcagcgatcccgcggtggccgacttggtggctgaccggttcggc
gaccaagtcgtggcccggtcggtggacccgctgttaagcggggtatacgcgggctcggcg
gcgacgatcgggctgcgcgcggccgccccgagcgtggccgcggccctggatcgcggggcg
accagtgtgaccgacgcggtccggcaggcgctgccgccgggaagcggcgggccggtgttc
ggcgcgctggacggcgggtatcaggtgctgctcgacgggctcgtccggcgcagccgggtg
cactgggtgcgggccagggtggtccagctcgaacgcggctgggtgctgcgcgacgaaacc
ggcggccgctggcaggccgacgccgtcatcctggcggttccggcgccgcggttggcgcgc
ctcgtcgatggcatcgcgccgcgcacacatgccgccgcccggcagatcgtgagcgcgtcg
tcggcggtggtggcgctggcggtgcccggcggcaccgcgtttccgcactgttccggcgtg
ctggtggccggcgacgagtcaccgcatgccaaggcgatcacattgtcgtcgcgcaaatgg
ggtcagcgcggcgacgtcgcgctgttgcggctgtcgttcggtcggttcggcgacgaaccg
gccctgacggcctccgacgaccaactcctggcctgggcagcggacgacttggtcacggtg
ttcggtgtggccgtcgacccggtcgacgttcgggtccggcgctggatcgaggcgatgccg
cagtacggtcccggccatgccgatgtggtcgccgagctgcgcgccggcctgccaccgacg
ctggccgttgcgggcagctacctcgacgggatcggcgtgccggcctgcgtcggcgcggcg
ggccgggccgtcaccagcgtcatcgaggccttagatgcgcaggtggcacgatag

DBGET integrated database retrieval system