KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_3318Help
Entry
ERDMAN_3318       CDS       T02526                                 

Definition
probable transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mtn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ERDMAN_3318
Enzymes [BR:mtn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ERDMAN_3318
Glycosyltransferases [BR:mtn01003]
 Polysaccharide
  Storage polysaccharide
   ERDMAN_3318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3377751..3378983
Genome map
AA seq 410 aa AA seqDB search
MVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEGVRVI
AAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAHPAIA
LAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMNDEITE
LFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPRLRRT
HPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPSHYEP
FGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPAAAQR
RARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgccacgtgcatcat
ctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcccggtgtccgtcg
ggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggggtccgggtgatt
gcggccgcgcaggacccgcacgagttcacgtttggcaacgacatgatggcctggaccctg
gcgatgggccacgccatgatccgcgccgggctgcgcttgaagaaacttggcaccgaccgc
tcgtggcgtcctgacgtcgtgcacgcacacgactggctggtggcccatccggccatcgcc
cttgcccagttctatgacgtgccaatggtttccacgattcatgcaacggaggccggtcga
cattccggctgggtctccggagctctcagccgtcaggtgcacgcggtcgagtcgtggctg
gtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgacgagatcaccgag
ctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcattgacgcggcgcgc
tggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctctatgtggggcgg
ctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcggctcaggcgcact
cacccaggcaccacactgaccatcgccggcgaaggcacccagcaggattggttgatcgat
caggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacacctcgaccacacc
gagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagccactacgaaccg
tttgggctggtggcactggaggccgccgcggccggcaccccgctggtgacgtccaacatc
ggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgtgcaccccgcgac
gtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggccgccgcgcagcgg
cgcgcacgagccgcccggcaacggctcacctccgacttcgactggcagacggtggccacc
gcgaccgcgcaggtgtacctggcggcgaagcgcggtgaacggcagccgcagccccggttg
cccatcgtcgagcacgctcttcccgatcggtag

DBGET integrated database retrieval system