KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_3352Help
Entry
ERDMAN_3352       CDS       T02526                                 

Gene name
ligB
Definition
ATP-dependent DNA ligase (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mtn00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ERDMAN_3352 (ligB)
   03420 Nucleotide excision repair
    ERDMAN_3352 (ligB)
   03430 Mismatch repair
    ERDMAN_3352 (ligB)
   03450 Non-homologous end-joining
    ERDMAN_3352 (ligB)
Enzymes [BR:mtn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ERDMAN_3352 (ligB)
DNA repair and recombination proteins [BR:mtn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ERDMAN_3352 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3411858..3413366
Genome map
AA seq 502 aa AA seqDB search
MAITSMDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGWAALRS
LPPPAPQPALTVTGVDATLSKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLRLLGGE
LRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGAALDTFTLRVGRPIG
PMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARLPEVVE
ATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHR
DGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKAPAA
RYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVMVGKTF
KGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLALRFARV
VRYRADKDPAEADTIDAVRALY
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcacctcaatggacgtggccgccacctcgtcgcggctgaccaaggtcgcgcgc
atcgccgccctgttgcaccgcgccgcgccagacacacagctggtcacgatcatcgtgtcg
tggctctccggcgagctgccgcaacgccatatcggtgtcgggtgggcggcattgcggtcc
ctaccgccgcccgcgccgcaaccggcgttgaccgtcaccggtgtcgacgccaccctctct
aagatcggcactctatcgggcaaagggtctcaggcgcagcgcgcggcactcgttgcggaa
ttgttctccgccgcaaccgaagctgagcaaacctttttgttgcgactgctcggcggtgaa
ctgcgccagggcgcaaagggcgggatcatggccgatgcggtcgcccaggccgccgggctc
ccggccgcgacggtccaacgcgccgcgatgctaggcggcgacctggcggcagcggcggcg
gccggcctgtccggcgcggcgctggacaccttcaccctgcgagtgggccgaccgataggc
ccgatgctggcacagaccgcgaccagcgtccatgatgcactcgaacgtcacggcggcaca
accattttcgaggctaaactagacggcgcgcgagtgcagatccaccgggcaaacgaccag
gtcaggatctacacccgaagcctggacgacgtcactgcccggctgcccgaggtggtggag
gcaacactggcactgccggtccgggatctagtggccgacggcgaggcgatcgcgctgtgc
ccggacaaccggccgcagcgtttccaggtcaccgcatcacggttcggccgatcggtcgat
gttgcggctgcccgcgcgacgcagccactttcggtgttcttcttcgacatcctgcatcgg
gatggtaccgacttgctcgaagcgccgaccaccgagcggctggccgccctggacgcactg
gtgccggctcggcaccgcgtggaccggctgatcacgtccgatccaacggacgcggccaac
ttcctggatgcgacgctggccgccggccacgagggggtgatggccaaggcaccggccgct
cgttaccttgcgggtcgccgcggagcgggctggctgaaggtcaagccggtgcacacactc
gacttggtggtgctcgcggtggaatggggctcgggacgccggcgcggcaagctctccaat
attcacctgggcgcacgcgatccggctaccggtggattcgtgatggtgggcaagaccttc
aaaggaatgaccgacgccatgctggactggcagaccaccaggtttcacgagatcgcggtg
ggtccgacagacggctacgtcgtccaacttaggcccgagcaggtggtcgaggtagccctc
gacggcgtgcaaaggtcgtcgcgctacccgggcgggctggcattgcggtttgcccgcgtg
gtgcgctaccgcgccgacaaggacccggccgaggccgacaccatcgatgccgtgcgcgcg
ctctactga

DBGET integrated database retrieval system