KEGG   Mycobacterium tuberculosis Erdman = ATCC 35801: ERDMAN_3862Help
Entry
ERDMAN_3862       CDS       T02526                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtn  Mycobacterium tuberculosis Erdman = ATCC 35801
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ERDMAN_3862
   00630 Glyoxylate and dicarboxylate metabolism
    ERDMAN_3862
   00640 Propanoate metabolism
    ERDMAN_3862
   00650 Butanoate metabolism
    ERDMAN_3862
  Lipid metabolism
   00071 Fatty acid degradation
    ERDMAN_3862
   00072 Synthesis and degradation of ketone bodies
    ERDMAN_3862
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ERDMAN_3862
   00310 Lysine degradation
    ERDMAN_3862
   00380 Tryptophan metabolism
    ERDMAN_3862
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ERDMAN_3862
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ERDMAN_3862
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ERDMAN_3862
Enzymes [BR:mtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ERDMAN_3862
Exosome [BR:mtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ERDMAN_3862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3940575..3941003
Genome map
AA seq 142 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctattcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggataa

DBGET integrated database retrieval system