KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_0494Help
Entry
MTCTRI2_0494      CDS       T01993                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00010  Glycolysis / Gluconeogenesis
mto00260  Glycine, serine and threonine metabolism
mto00680  Methane metabolism
mto01100  Metabolic pathways
mto01110  Biosynthesis of secondary metabolites
mto01120  Microbial metabolism in diverse environments
mto01130  Biosynthesis of antibiotics
mto01200  Carbon metabolism
mto01230  Biosynthesis of amino acids
Module
mto_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mto_M00002  Glycolysis, core module involving three-carbon compounds
mto_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTCTRI2_0494 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MTCTRI2_0494 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTCTRI2_0494 (gpmA)
Enzymes [BR:mto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MTCTRI2_0494 (gpmA)
Membrane trafficking [BR:mto04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MTCTRI2_0494 (gpmA)
Exosome [BR:mto04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MTCTRI2_0494 (gpmA)
  Exosomal proteins of melanoma cells
   MTCTRI2_0494 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEM98937
Structure
PDB: 

Jmol
Position
578030..578779
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system