KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1120Help
Entry
MTCTRI2_1120      CDS       T01993                                 

Gene name
celA2b
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTCTRI2_1120 (celA2b)
Enzymes [BR:mto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MTCTRI2_1120 (celA2b)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216036..1216491
Genome map
AA seq 151 aa AA seqDB search
MGTNLPTEVGQILSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQQEIMIWFNHQGS
IQPVGSPVGNTTIEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPIT
DSWYLTSIRAGLEPWSDGVGLGVDSFSAKVN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaccaacctgcctactgaggtgggccagattttgtcggcgccgaccagcatcgac
tacaactacccgacgaccggggtatgggacgcctcctacgacatctgcctggattccaca
cccaagacgaccggggtcaaccagcaggagatcatgatctggttcaaccaccagggctcc
attcagccggtcggctccccggtgggcaacaccaccatcgagggcaagaacttcgtggtg
tgggatggcagcaacggcatgaacaacgcgatggcctatgtcgcgaccgagccgatcgag
gtctggagcttcgacgtgatgagtttcgtcgaccacaccgccaccatggagccgatcacc
gactcgtggtacctcacgagcatccgggccggcttggagccctggagcgacggtgtgggt
ctgggggtcgattcgttctcggcgaaagtcaactaa

DBGET integrated database retrieval system