KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1167Help
Entry
MTCTRI2_1167      CDS       T01993                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTCTRI2_1167
   00630 Glyoxylate and dicarboxylate metabolism
    MTCTRI2_1167
   00640 Propanoate metabolism
    MTCTRI2_1167
   00650 Butanoate metabolism
    MTCTRI2_1167
  Lipid metabolism
   00071 Fatty acid degradation
    MTCTRI2_1167
   00072 Synthesis and degradation of ketone bodies
    MTCTRI2_1167
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTCTRI2_1167
   00310 Lysine degradation
    MTCTRI2_1167
   00380 Tryptophan metabolism
    MTCTRI2_1167
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MTCTRI2_1167
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MTCTRI2_1167
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MTCTRI2_1167
Enzymes [BR:mto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MTCTRI2_1167
Exosome [BR:mto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MTCTRI2_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1264676..1264918
Genome map
AA seq 80 aa AA seqDB search
MQLGNQNTMRFAGRPQRFRQSAYPLFNPNSAIALGHPFGGSGARLMTTVLHHMPDKGIRY
GLQTMCEGRGQANATIVELL
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttggcaatcaaaacactatgagattcgcagggcggcctcagcgttttcgccaa
agcgcttaccccctgttcaaccccaacagcgcgatcgcgcttggccacccattcggcggc
tcgggggcacggttgatgactacagtgctacaccacatgccggacaagggaattcgctac
ggcttacagacgatgtgcgagggccgcggccaagccaatgccaccattgtggagttgctg
tga

DBGET integrated database retrieval system