KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1233Help
Entry
MTCTRI2_1233      CDS       T01993                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mto01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mto00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345623..1346687
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIELTAALIDIPSESRKEARIADEVEAALRAQASGFEIIRNGNAVLARTKLNR
SSRVLLAGHLDTVPVAGNLPSRRENDQLHGCGAADMKSGDAVFLHLAATLAEPTHDLTLV
FYDCEEIDSAANGLGRIQRELPDWLSADVAILGEPTAGCIEAGCQGTLRVVLSVTGTRAH
SARSWLGDNAIHKLGAVLDRLAVYRARSVDIDGCTYREGLSAVRVAGGVAGNVIPDAASV
TINYRFAPDRSVAAALQHVHDVFDGLDVQIEQTDAAAGALPGLSEPAAKALVEAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHCRDERVPVGNITAAVDLLRRYLGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatttgcgcggggacccgatcgaattgaccgcggcgctgattgacatccccagc
gagtcgaggaaggaggcacgcatcgccgacgaggtggaagcggcgttgcgcgctcaggca
tcggggttcgagatcatccgcaacggcaacgcggtgctggcgcgtacaaagctgaaccgg
tcctcgcgggtgctgttggccggacacctggacaccgtgccagtggccggcaacctgcct
agccgccgcgagaacgaccagctgcacggctgcggcgcagccgacatgaaatccggcgac
gcggtcttccttcatctggccgctacactggccgaaccgacgcacgatctaacactggtg
ttctacgactgcgaggaaatcgattcggcggcaaacggtttaggccgcatccagcgcgag
ctgccggactggctatccgcggatgtagccatcttgggtgagcccaccgccggctgcatc
gaggctggttgccagggcacgttgcgtgtcgtcctcagcgtgaccggaactcgcgcgcat
tcagcgcgttcgtggttgggtgacaacgcaatccacaagttgggtgctgtgctggaccgg
ttggccgtctaccgggcacgcagcgtcgacatcgacggttgcacctatcgggagggcctc
tcggcggtgcgcgtagcaggcggcgtcgccggcaacgtgatccctgacgcggcctcggtc
acgatcaactaccgctttgcccccgaccggtcggtggccgcggcattgcaacatgtccat
gacgtgttcgacgggctcgacgtgcagatcgagcagacggacgccgcggccggtgcgctg
cctggcctgtccgagcccgcggccaaggcgctggtcgaggccgccggcgggcaggtccgg
gccaagtatggctggactgatgtgtcgcgctttgccgctttgggcataccggcggtcaat
tacggcccgggtgatcccaacctggcgcactgccgcgacgaacgggtgcccgtcggcaac
atcaccgcggccgtggacttgctgcgccgatacctgggtggctag

DBGET integrated database retrieval system