KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1238Help
Entry
MTCTRI2_1238      CDS       T01993                                 

Gene name
folP2
Definition
dihydropteroate synthase 2 FolP2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MTCTRI2_1238 (folP2)
Enzymes [BR:mto01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MTCTRI2_1238 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1351554..1352510
Genome map
AA seq 318 aa AA seqDB search
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGA
TFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLI
SVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRV
SYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLV
MTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEM
VASIQGVRPPTRTVRGLA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttcaacaccgccggcctcagccggtcgttcaacaccgccggcgttagccggccat
tcaacaccgccggcgttagccggccattcaacgctgtgcggccgtccagtcgcaggtgat
cgtgcgctgatcatggcgatcgtcaaccgcaccccggattcgttttacgacaagggtgcg
actttcagcgacgcggctgccagagacgcggtccaccgggccgtcgccgacggtgccgac
gtcatcgacgtcggcggtgtcaaagccggcccgggtgaacgcgtcgacgtcgacaccgag
atcacgcggctggtgccgttcatcgaatggctccgcggtgcttacccggaccagctgatc
agtgtcgacacctggcgcgcgcaggtggcgaaggcggcctgcgcggcgggggcggacctg
atcaacgacacctggggtggcgtcgacccggccatgcccgaggtggccgccgagttcggc
gcgggcctggtgtgtgcgcacaccggcggcgcgctgccacgcacgcgacccttccgggtg
agctacggtacgactacccgcggtgtggtggatgctgtgattagccaggtcacagccgcc
gccgagcgggccgtcgcggccggggtggcccgcgagaaggtgttgatcgacccggcacac
gacttcggcaagaacaccttccatgggctgctgctattgcgacacgtggccgatcttgtt
atgaccgggtggcccgtgctgatggctttgagcaacaaggacgttgtcggggagactctg
ggcgtggatttgaccgaacggcttgagggaacgctggcagccaccgcgttggctgcggcc
gccggggcgcgcatgtttcgggtgcatgaggtcgccgccacccggcgggtgctggaaatg
gtggcatcgattcagggggtccggccgccgacgcgcacggtgagaggactcgcatga

DBGET integrated database retrieval system