KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1639Help
Entry
MTCTRI2_1639      CDS       T01993                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mto01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mto00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mto00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1802378..1803610
Genome map
AA seq 410 aa AA seqDB search
MSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKERVSQDFLDDLDR
LQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRV
IAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSKTL
KDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAGRLPDA
VVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPGAFHGSFSYL
LQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMDAFGLLCRMEGII
PAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLGND
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgccatcgccgaaccgaccagtcacgatcctgattccggcggccatttcggc
ggccccagtggttggggtggccgctacgttcccgaggcgctgatggcggtgatcgaagag
gtcaccgccgcctaccaaaaggagcgcgtcagccaggactttctggacgacctagacagg
ctgcaggcgaactatgcgggccggccttcgccgctttacgaggcgacccggttgagccag
cacgctgggtcggcgcgaatctttctgaagcgagaagacctgaaccatactggttctcac
aagatcaacaacgtgctcgggcaggcactgctggcgcgcaggatgggcaagacccgggtg
atcgccgagaccggtgccggccagcacggggtcgccacggccaccgcatgcgcattgctc
ggcctggactgtgtcatctacatggggggcatcgacaccgcccgtcaggcgctaaacgtg
gcccggatgcgattgctgggtgccgaagtcgtcgcggttcagacgggctcgaaaacgctc
aaagacgccatcaatgaggcgttccgggattgggttgccaacgccgacaacacctactac
tgctttggtactgcggccggaccgcatccgtttccaaccatggtgcgcgatttccagcga
atcatcggcatggaggcacgtgtgcagatccagggtcaggccggtcggctgcctgacgcc
gtcgtcgcgtgcgttggtggcgggtccaatgccattggtatttttcatgcgtttctcgat
gacccaggcgtacggctggtcggattcgaggcagccggcgacggcgttgagaccggccgg
catgccgcgacattcaccgctggttcgcccggggcatttcacggatcgttctcgtacttg
ctgcaagacgaggacggtcagaccattgaatcccattcaatttccgcgggtctggattat
ccgggggtgggcccggaacatgcgtggctcaaggaggccgggcgtgtcgattatcggccg
atcaccgactccgaggcgatggacgcgtttggcctgctgtgtcgcatggaaggcatcatc
ccggctattgaatccgcgcacgcggtggccggcgccctcaagctaggtgttgagttggga
aggggcgcggtgattgtggtgaacctgtcgggacgtggcgacaaagatgtcgagacggcc
gcgaaatggtttggcttgctgggcaacgactga

DBGET integrated database retrieval system