KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1732Help
Entry
MTCTRI2_1732      CDS       T01993                                 

Definition
catechol-o-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MTCTRI2_1732
Enzymes [BR:mto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MTCTRI2_1732
Exosome [BR:mto04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MTCTRI2_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1921753..1922343)
Genome map
AA seq 196 aa AA seqDB search
MLATIDKFAYEKSMLINVGDEKGTLLDAAVRRADPALALELGTYLGYGALRIARAAPEAR
VYSVELAEANASNARRIWAHAGVDDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLD
HDKKAYLPDLQSILDRGWLHPGSIVVADNVRVPGAPKYRAYMRRQQGMSWNTIEHKTHLE
YQTLVPDLVLESEYLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaccatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgac
gagaaagggacgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggag
ttgggcacctacctcggctacggcgcgctgcggatcgcccgggccgctccggaggccagg
gtgtactccgtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcat
gccggcgtcgatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcacc
ctggacgcgctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgac
catgacaagaaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcac
ccgggctcgatcgtggttgccgacaatgtcagggtgcccggcgcgccgaagtaccgtgca
tatatgcgccggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaa
taccagaccctggtgcccgacttggtattggagtccgaatacctgggttag

  All links  
No link information was found.   
DBGET integrated database retrieval system