KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1948Help
Entry
MTCTRI2_1948      CDS       T01993                                 

Gene name
aceAa
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTCTRI2_1948 (aceAa)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MTCTRI2_1948 (aceAa)
Enzymes [BR:mto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MTCTRI2_1948 (aceAa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2154239..2155342
Genome map
AA seq 367 aa AA seqDB search
MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQRGTIPVDHIVA
REAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGIEAIYLGGWATSAKGSSTEDP
GPDLASYPLSQVPDDAAVLVRALLTADRNQHYLRLQMSERQRAATPAYDFRPFIIADAGT
GHGGDPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQL
DIMRVPGIIVARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFTNWAS
RSSMVIFSMRLATASTRRPAVGLSAKAFSAWSPTRSTRGGRTASSRSTAFSTRSSRGSWR
PGRTTRA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgaaacggacaccgaggtccacacaccgttcgagcaggactttgagaaa
gacgtagccgccactcagcgatacttcgacagctcgcgctttgctgggatcattcggctc
tacaccgcccgccaagtcgtggaacagcgcggcacgatccccgtcgaccacatcgtggcg
cgagaggcggcgggcgccttctacgagcgtctgcgcgaactctttgcagcccgcaagagc
atcacgacgtttggcccctactcgccggggcaggcggtgagcatgaagcggatgggtatc
gaggcgatctacctcggtggttgggctacctcagctaagggctccagcaccgaagatccg
gggcccgacctcgccagctacccgctgagccaggtgcctgacgatgccgcggtgctggtg
cgcgccttgctcaccgcggaccgcaaccaacactatctacgcctgcagatgagcgagcga
cagcgtgcggcgacaccggcttacgacttccgcccgtttatcatcgccgacgccggcacc
ggccacggcggcgatccgcacgtacgcaacctgatccgccgcttcgtcgaggtcggtgtg
ccgggctaccacatcgaggaccaacgacccggcaccaagaagtgcggccaccagggcggc
aaggtcctggtgccgtccgacgaacagatcaagcggctcaacgccgcccgcttccagctc
gacatcatgcgggtgcccggcatcatcgtcgcacgcaccgacgcggaggcggccaacctg
atcgacagtcgcgccgacgagcgtgaccagccgttccttctcggcgcgaccaagctcgac
gtaccgtcctacaagtcctgtttcctggcaatggtgcggcgttttacgaactgggcgtca
aggagctcaatggtcatcttctctatgcgcttggcgacagcgagtacgcggcggccggcg
gttggcttgagcgccaaggcattttcggcttggtctccgacgcggtcaacgcgtggcggg
aggacggccagcagtcgatcgacggcattttcgaccaggtcgagtcgcggttcgtggcgg
cctgggaggacgacgcgggcctga

DBGET integrated database retrieval system