KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_1968Help
Entry
MTCTRI2_1968      CDS       T01993                                 

Gene name
echA13
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00071  Fatty acid degradation
mto00280  Valine, leucine and isoleucine degradation
mto00281  Geraniol degradation
mto00310  Lysine degradation
mto00360  Phenylalanine metabolism
mto00362  Benzoate degradation
mto00380  Tryptophan metabolism
mto00410  beta-Alanine metabolism
mto00627  Aminobenzoate degradation
mto00640  Propanoate metabolism
mto00650  Butanoate metabolism
mto00903  Limonene and pinene degradation
mto00930  Caprolactam degradation
mto01100  Metabolic pathways
mto01110  Biosynthesis of secondary metabolites
mto01120  Microbial metabolism in diverse environments
mto01130  Biosynthesis of antibiotics
mto01212  Fatty acid metabolism
Module
mto_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MTCTRI2_1968 (echA13)
   00650 Butanoate metabolism
    MTCTRI2_1968 (echA13)
  Lipid metabolism
   00071 Fatty acid degradation
    MTCTRI2_1968 (echA13)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTCTRI2_1968 (echA13)
   00310 Lysine degradation
    MTCTRI2_1968 (echA13)
   00360 Phenylalanine metabolism
    MTCTRI2_1968 (echA13)
   00380 Tryptophan metabolism
    MTCTRI2_1968 (echA13)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTCTRI2_1968 (echA13)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MTCTRI2_1968 (echA13)
   00281 Geraniol degradation
    MTCTRI2_1968 (echA13)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MTCTRI2_1968 (echA13)
   00627 Aminobenzoate degradation
    MTCTRI2_1968 (echA13)
   00930 Caprolactam degradation
    MTCTRI2_1968 (echA13)
Enzymes [BR:mto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MTCTRI2_1968 (echA13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEN00388
Position
complement(2179766..2180722)
Genome map
AA seq 318 aa AA seqDB search
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIGADEAHALGMVSKVFPADELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRAAPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcggcagggtcggtccggtcgatcgccggtcggacggggaacgctcccgacgg
ccccgggagttcgaatacatccgctacgaaaccatcgacgatgggcgcatcgccgcgatc
accctggaccgcccgaaacaacgcaacgcccagacccgcggcatgctggtcgagctgggc
gccgccttcgaacttgccgaggcggacgacaccgtccgggtggtgatcctgcgggccgcc
ggccccgccttctccgccggtcacgacctcggatccgctgacgatatccgggaacgctcg
cccgggccggaccagcaccccagctaccggtgcaacggggcgaccttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggccgtgctgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgatgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggacatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcataggcgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgctgacgaactcgcgaccagcacaatcgaattcgcgcgt
cggatcgcgaaggtgccgacgatggcggcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcgctggacggttgcttcaagatccaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacggc
ctggaggactggcgcgccgcaccgcagatccggcccgcgatcaagcagcggccctga

DBGET integrated database retrieval system