KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_3385Help
Entry
MTCTRI2_3385      CDS       T01993                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor subunit SdhD
  KO
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTCTRI2_3385 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MTCTRI2_3385 (sdhD)
   00650 Butanoate metabolism
    MTCTRI2_3385 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MTCTRI2_3385 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
3698814..3699248
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system