KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_3446Help
Entry
MTCTRI2_3446      CDS       T01993                                 

Gene name
echA18
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MTCTRI2_3446 (echA18)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MTCTRI2_3446 (echA18)
   00650 Butanoate metabolism
    MTCTRI2_3446 (echA18)
  Lipid metabolism
   00071 Fatty acid degradation
    MTCTRI2_3446 (echA18)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTCTRI2_3446 (echA18)
   00310 Lysine degradation
    MTCTRI2_3446 (echA18)
   00360 Phenylalanine metabolism
    MTCTRI2_3446 (echA18)
   00380 Tryptophan metabolism
    MTCTRI2_3446 (echA18)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTCTRI2_3446 (echA18)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MTCTRI2_3446 (echA18)
   00281 Geraniol degradation
    MTCTRI2_3446 (echA18)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MTCTRI2_3446 (echA18)
   00627 Aminobenzoate degradation
    MTCTRI2_3446 (echA18)
   00930 Caprolactam degradation
    MTCTRI2_3446 (echA18)
Enzymes [BR:mto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MTCTRI2_3446 (echA18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3786140..3786781
Genome map
AA seq 213 aa AA seqDB search
MRRRAMTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQ
NALNLASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYN
ESLAVCLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGF
TEADTVARLIGPAALKYLLFSGELIGIEEAARW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggcgtgcaatgacgaagatggacgaggctagcaatccgtgcggcggggacatc
gaagctgagatgtgccagttgatgcgcgagcaaccacccgccgaaggcgtcgtcgatcgt
gtcgcgctgcaacgccatcgaaacgttgcgttgatcacgctgagccatccgcaggcgcag
aacgcactcaacctggcgagctggcgtcggctgaagcggctgctggacgatctcgccggc
gaatcggggctgcgggcggtggtgctgcggggcgccggtgacaaggcgttcgccgcgggt
gccgacatcaaggagtttccgaacacccgcatgagcgccgcggacgccgcggagtacaac
gagagcctggccgtctgcctgagggcgttgaccacgatgccgatcccagtcatcgcggcg
gtccgggggctcgccgtcggtggcggctgtgagctggcgacggcctgcgatgtgtgcatc
gcgaccgacgacgcgcgcttcggcatcccgctgggcaagctcggcgtcacgacgggcttc
accgaggcggacaccgtcgcgcgcctcatcggtccggcggcgctgaagtatctgttgttc
agcggagaactgatcggcattgaggaagccgcccgctggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system