KEGG   Mycobacterium tuberculosis CTRI-2: MTCTRI2_3599Help
Entry
MTCTRI2_3599      CDS       T01993                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mto  Mycobacterium tuberculosis CTRI-2
Pathway
mto00360  Phenylalanine metabolism
mto00362  Benzoate degradation
mto00620  Pyruvate metabolism
mto00621  Dioxin degradation
mto00622  Xylene degradation
mto00650  Butanoate metabolism
mto01100  Metabolic pathways
mto01120  Microbial metabolism in diverse environments
mto01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mto00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTCTRI2_3599
   00650 Butanoate metabolism
    MTCTRI2_3599
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MTCTRI2_3599
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MTCTRI2_3599
   00622 Xylene degradation
    MTCTRI2_3599
   00621 Dioxin degradation
    MTCTRI2_3599
Enzymes [BR:mto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MTCTRI2_3599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEN01998
Structure
PDB: 

Jmol
Position
complement(3959057..3959968)
Genome map
AA seq 303 aa AA seqDB search
MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVD
WLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTPAAVGPAVIPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQT
IGRAARGKAIIILNPADPPMIMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLL
NEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcaaaagtggcgattgtcgggtcgggaaatatcagcaccgatctgctg
tacaagctgctgcgatcggagtggctggagccgcgctggatggtgggcatcgacccggag
agcgatggcctggcgcgcgcggccaagctgggtttggagaccacccacgagggggtggac
tggctgctggcgcagcccgataaacccgacctggtgttcgaggcaaccagtgcctacgtg
caccgggacgcggcgcccaagtacgccgaggccgggatccgggccatcgacctgacgccg
gcggcggtgggtccggcggtgatcccgccggcgaacctgcgcgagcacctggacgcgccg
aacgtcaacatgatcacctgcgggggacaggcgaccattccgatcgtgtacgcggtgtct
cggatcgtggaggtgccctacgccgagatcgtggcgtcggtggcttccgtttcagcggga
ccgggcacgcgcgccaacatcgacgagttcaccaagaccaccgcccgtggggtccagacc
atcggcagggccgcccgcggcaaggcgatcatcatcttgaatcccgccgacccgccgatg
atcatgcgcgacaccatcttttgcgccatccccaccgacgccgaccgcgaagcgatcgcc
gcctccatccacgacgtcgtcaaagaggtgcagacctacgtgcctggataccggctgctc
aacgaaccgcagttcgacgagccgtcgatcaactcgggcgggcaggcgctggtcaccacg
ttcgtcgaggttgagggcgccggggattacctgccgccctatgcgggcaacctggacatc
atgaccgcggcggccaccaaggtgggcgaggagatcgccaaggagacgctggttgtagga
ggagcgcgatga

DBGET integrated database retrieval system