KEGG   Methanosaeta thermophila: Mthe_0041Help
Entry
Mthe_0041         CDS       T00417                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mtp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtp00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtp00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mtp00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
37597..38292
Genome map
AA seq 231 aa AA seqDB search
MRWSQSLGGMALTLIVLNFKTYREATGDSAVALSKICESIASEYGVDIAVAPQAADIRAV
ASAVSIPVYAQHVDGVGFGSFTGHITAASVKAAGASGSLINHSERRLRLADIEASLRACR
SEGLTSIICTNNVATTRAAAALRPDYVAVEPPELIGSGIPVSKADPEVVRGSVEAVRAIE
KDVGVLCGAGITHGDDLRAAIELGAVGVLLASGIVKAKDQRKALEDLVTGV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtcacagagtttaggtgggatggctttgacgctgatagttctcaacttcaaa
acctacagggaagcgacaggagattcggctgtcgccctatcaaagatatgcgagagcata
gcctctgagtatggcgtcgatatcgcggttgcgccacaggccgctgatataagagcggtc
gcatccgccgtgagcataccggtttatgcgcagcacgtcgatggcgtcggcttcggcagc
ttcacagggcacatcacagctgcgtctgtgaaggctgcaggggcatccggttctctcata
aatcactcagagcgccggctcaggcttgctgacatcgaggcgtctctcagggcgtgcagg
tcagaggggctcacgtcgataatatgcacgaacaacgtcgcaacaacaagagcggctgca
gccttgcggcctgattatgtcgctgtggagccgccagagctcataggctctgggattcct
gtctccaaggcagatcctgaggtcgtcaggggctcggtcgaggctgtaagagcgatagag
aaggatgtcggcgtgctctgcggcgcaggaatcacccacggagacgatctcagagccgct
atcgagctcggcgctgtgggcgttcttcttgcctcagggatcgtgaaggcgaaggaccag
cgtaaggcgctcgaggatctggtgacaggggtttga

DBGET integrated database retrieval system