KEGG   Methanosaeta thermophila: Mthe_0041Help
Entry
Mthe_0041         CDS       T00417                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mthe_0041
   01230 Biosynthesis of amino acids
    Mthe_0041
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_0041
   00051 Fructose and mannose metabolism
    Mthe_0041
   00562 Inositol phosphate metabolism
    Mthe_0041
Enzymes [BR:mtp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mthe_0041
Exosome [BR:mtp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mthe_0041
  Exosomal proteins of bladder cancer cells
   Mthe_0041
  Exosomal proteins of melanoma cells
   Mthe_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
37597..38292
Genome map
AA seq 231 aa AA seqDB search
MRWSQSLGGMALTLIVLNFKTYREATGDSAVALSKICESIASEYGVDIAVAPQAADIRAV
ASAVSIPVYAQHVDGVGFGSFTGHITAASVKAAGASGSLINHSERRLRLADIEASLRACR
SEGLTSIICTNNVATTRAAAALRPDYVAVEPPELIGSGIPVSKADPEVVRGSVEAVRAIE
KDVGVLCGAGITHGDDLRAAIELGAVGVLLASGIVKAKDQRKALEDLVTGV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtcacagagtttaggtgggatggctttgacgctgatagttctcaacttcaaa
acctacagggaagcgacaggagattcggctgtcgccctatcaaagatatgcgagagcata
gcctctgagtatggcgtcgatatcgcggttgcgccacaggccgctgatataagagcggtc
gcatccgccgtgagcataccggtttatgcgcagcacgtcgatggcgtcggcttcggcagc
ttcacagggcacatcacagctgcgtctgtgaaggctgcaggggcatccggttctctcata
aatcactcagagcgccggctcaggcttgctgacatcgaggcgtctctcagggcgtgcagg
tcagaggggctcacgtcgataatatgcacgaacaacgtcgcaacaacaagagcggctgca
gccttgcggcctgattatgtcgctgtggagccgccagagctcataggctctgggattcct
gtctccaaggcagatcctgaggtcgtcaggggctcggtcgaggctgtaagagcgatagag
aaggatgtcggcgtgctctgcggcgcaggaatcacccacggagacgatctcagagccgct
atcgagctcggcgctgtgggcgttcttcttgcctcagggatcgtgaaggcgaaggaccag
cgtaaggcgctcgaggatctggtgacaggggtttga

DBGET integrated database retrieval system