KEGG   Methanosaeta thermophila: Mthe_0155Help
Entry
Mthe_0155         CDS       T00417                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mthe_0155
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_0155
   00620 Pyruvate metabolism
    Mthe_0155
   00640 Propanoate metabolism
    Mthe_0155
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_0155
   00680 Methane metabolism
    Mthe_0155
Enzymes [BR:mtp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mthe_0155
Lipid biosynthesis proteins [BR:mtp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mthe_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
146646..148529
Genome map
AA seq 627 aa AA seqDB search
MASLLHKFVSRVEFDSYEDFRNNFRIIVPENFNFAYDVVDVYAQEQPDKIALVWCNDHGE
ERIFTFKDMKHWSDRAANLFSSYGIRKGDTVMLTLKSRYDFWICMIGLNKIGAVAIPSTH
MLKAKDIVYRIKKANLKMVVCIIEDGVPEEVDLAHKELGDVNLIKAFVGREDQEREGWIN
FRRALAEASPDFTRPVGEEATRNEDVLIAYFTSGTTGYPKMVKHDQTYPLGHILTAKYWQ
NVADDGLHYTVADTGWAKCAWGKIYGQWIAGSAVFVYDYDRFDAGRMMEKLSKYKVTTFC
APPTIYRFMIKGDMSKYDFSTLKYAVTAGEPLNPSVYERFLEVTGLKLMEGYGQTETVVT
IANFPWMEPKPGSMGKPAPGFDIVLLKDSRQCEVGEEGEIVIRTDKGKPVGLFIDYHLDP
DRVRNTWHDGYYHTGDTAWVDEDGYIWFVGRTDDMIKTSGYRVGPFEVESALMTHPAVLE
CAITGVPDPIRGQVIKATVVLTKGYTPSEELKRELQEHVKRVTAPYKYPRIVEFVEELPK
TISGKIRRVEIREKDKPYPIINAMECKGCERCILACPVNVLRMSEELNSRGYRYSVYAGD
GCIGCGACYYTCPEPNALAVHIPSKGE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
ttggcatcgcttctgcacaagtttgtgtcaagggtcgagttcgactcatacgaggatttc
aggaacaacttcagaataattgttccggagaacttcaacttcgcctacgatgtcgtcgat
gtttacgctcaggagcaacctgataagatcgctctggtctggtgcaacgatcacggtgag
gagaggatcttcacattcaaggacatgaagcactggagcgacagggcggccaatctcttc
agtagctacggaatcagaaaaggcgatactgtgatgctcacgctgaagagccgctatgac
ttctggatctgcatgataggcctcaacaagattggggcggtggcaatcccgtcaacccac
atgctcaaggcgaaggacatcgtctacagaataaaaaaggctaacctgaagatggtcgtc
tgcataatagaggatggagtgccagaggaggtagatctcgctcataaagagctcggcgat
gtgaatctcataaaagcatttgtgggcagagaggatcaggagagggagggatggataaac
ttcaggcgcgcgctcgctgaggcatctcctgatttcacaagacctgtgggggaggaggcc
accaggaacgaggatgttctcatagcctacttcacctccggaaccacgggctacccgaag
atggtgaaacacgaccaaacatatccgctgggacacatactcacagcgaagtactggcag
aacgtcgcagacgatggactgcactacacggtcgcggatacaggctgggcgaagtgcgcc
tggggcaagatatacggccagtggatagctggctcggcggtctttgtctacgactacgac
aggtttgacgctggaagaatgatggagaagctatcaaagtataaggtcacaacgttctgc
gcccctccgacgatctacaggttcatgatcaagggggacatgtcgaagtacgatttctcc
acattaaaatacgcggtcactgcgggcgagccgctgaacccatctgtgtatgagaggttc
ctggaggtcacaggcctcaagctcatggagggctacggccagactgagactgtggtgacg
atagcgaacttcccctggatggagccgaagcctggatccatgggcaagcccgcgcccggc
ttcgatatagtcctcctgaaggacagcaggcaatgcgaggtgggcgaggagggtgagatc
gtaatccgcacggataagggaaagccggttgggctcttcatagactaccacctcgatcca
gacagggtgaggaacacctggcacgatggatactatcacacgggagataccgcgtgggtc
gacgaggacgggtacatatggtttgttggcaggacagacgacatgataaagacctccggc
tacagggtcgggccgtttgaggtcgagagcgccctgatgactcatcccgcagtcctggag
tgtgctataacaggcgtccccgatccgatcagagggcaggtgatcaaggcgaccgtggtt
cttacaaagggctacacgccatcagaggagctgaagagagagctgcaggagcatgtcaag
agggtaacagccccctacaagtaccccagaatcgtggagtttgtggaggagctcccgaag
acgataagcggaaagatacgcagggtcgagatcagggagaaggacaagccgtatccgatt
ataaacgcaatggagtgcaaggggtgtgagcggtgcattctcgcatgccctgtgaacgtg
ctcaggatgagtgaggagctgaacagcaggggctacaggtattccgtgtacgcaggagat
gggtgcatagggtgcggcgcgtgctactacacatgccccgagccgaacgcgcttgctgtt
cacataccatcaaagggcgagtga

DBGET integrated database retrieval system