KEGG   Methanosaeta thermophila: Mthe_0155Help
Entry
Mthe_0155         CDS       T00417                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mtp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtp00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mtp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mtp00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mtp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
146646..148529
Genome map
AA seq 627 aa AA seqDB search
MASLLHKFVSRVEFDSYEDFRNNFRIIVPENFNFAYDVVDVYAQEQPDKIALVWCNDHGE
ERIFTFKDMKHWSDRAANLFSSYGIRKGDTVMLTLKSRYDFWICMIGLNKIGAVAIPSTH
MLKAKDIVYRIKKANLKMVVCIIEDGVPEEVDLAHKELGDVNLIKAFVGREDQEREGWIN
FRRALAEASPDFTRPVGEEATRNEDVLIAYFTSGTTGYPKMVKHDQTYPLGHILTAKYWQ
NVADDGLHYTVADTGWAKCAWGKIYGQWIAGSAVFVYDYDRFDAGRMMEKLSKYKVTTFC
APPTIYRFMIKGDMSKYDFSTLKYAVTAGEPLNPSVYERFLEVTGLKLMEGYGQTETVVT
IANFPWMEPKPGSMGKPAPGFDIVLLKDSRQCEVGEEGEIVIRTDKGKPVGLFIDYHLDP
DRVRNTWHDGYYHTGDTAWVDEDGYIWFVGRTDDMIKTSGYRVGPFEVESALMTHPAVLE
CAITGVPDPIRGQVIKATVVLTKGYTPSEELKRELQEHVKRVTAPYKYPRIVEFVEELPK
TISGKIRRVEIREKDKPYPIINAMECKGCERCILACPVNVLRMSEELNSRGYRYSVYAGD
GCIGCGACYYTCPEPNALAVHIPSKGE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
ttggcatcgcttctgcacaagtttgtgtcaagggtcgagttcgactcatacgaggatttc
aggaacaacttcagaataattgttccggagaacttcaacttcgcctacgatgtcgtcgat
gtttacgctcaggagcaacctgataagatcgctctggtctggtgcaacgatcacggtgag
gagaggatcttcacattcaaggacatgaagcactggagcgacagggcggccaatctcttc
agtagctacggaatcagaaaaggcgatactgtgatgctcacgctgaagagccgctatgac
ttctggatctgcatgataggcctcaacaagattggggcggtggcaatcccgtcaacccac
atgctcaaggcgaaggacatcgtctacagaataaaaaaggctaacctgaagatggtcgtc
tgcataatagaggatggagtgccagaggaggtagatctcgctcataaagagctcggcgat
gtgaatctcataaaagcatttgtgggcagagaggatcaggagagggagggatggataaac
ttcaggcgcgcgctcgctgaggcatctcctgatttcacaagacctgtgggggaggaggcc
accaggaacgaggatgttctcatagcctacttcacctccggaaccacgggctacccgaag
atggtgaaacacgaccaaacatatccgctgggacacatactcacagcgaagtactggcag
aacgtcgcagacgatggactgcactacacggtcgcggatacaggctgggcgaagtgcgcc
tggggcaagatatacggccagtggatagctggctcggcggtctttgtctacgactacgac
aggtttgacgctggaagaatgatggagaagctatcaaagtataaggtcacaacgttctgc
gcccctccgacgatctacaggttcatgatcaagggggacatgtcgaagtacgatttctcc
acattaaaatacgcggtcactgcgggcgagccgctgaacccatctgtgtatgagaggttc
ctggaggtcacaggcctcaagctcatggagggctacggccagactgagactgtggtgacg
atagcgaacttcccctggatggagccgaagcctggatccatgggcaagcccgcgcccggc
ttcgatatagtcctcctgaaggacagcaggcaatgcgaggtgggcgaggagggtgagatc
gtaatccgcacggataagggaaagccggttgggctcttcatagactaccacctcgatcca
gacagggtgaggaacacctggcacgatggatactatcacacgggagataccgcgtgggtc
gacgaggacgggtacatatggtttgttggcaggacagacgacatgataaagacctccggc
tacagggtcgggccgtttgaggtcgagagcgccctgatgactcatcccgcagtcctggag
tgtgctataacaggcgtccccgatccgatcagagggcaggtgatcaaggcgaccgtggtt
cttacaaagggctacacgccatcagaggagctgaagagagagctgcaggagcatgtcaag
agggtaacagccccctacaagtaccccagaatcgtggagtttgtggaggagctcccgaag
acgataagcggaaagatacgcagggtcgagatcagggagaaggacaagccgtatccgatt
ataaacgcaatggagtgcaaggggtgtgagcggtgcattctcgcatgccctgtgaacgtg
ctcaggatgagtgaggagctgaacagcaggggctacaggtattccgtgtacgcaggagat
gggtgcatagggtgcggcgcgtgctactacacatgccccgagccgaacgcgcttgctgtt
cacataccatcaaagggcgagtga

DBGET integrated database retrieval system