KEGG   Methanosaeta thermophila: Mthe_0192Help
Entry
Mthe_0192         CDS       T00417                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00260  Glycine, serine and threonine metabolism
mtp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01130  Biosynthesis of antibiotics
mtp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mthe_0192
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mthe_0192
Enzymes [BR:mtp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mthe_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ABK13991
JGI: Mthe0192
UniProt: A0B5L7
Position
complement(187117..187920)
Genome map
AA seq 267 aa AA seqDB search
MTPSDMSLYEVFRRCRPLIVYICAGDPSPDETVDIADRIVRAGADVLELGLPHSDPIADG
PVIQAASQRAIAAGMNTDLYFDVASKIDGVPKVFMGYYNMVYRRGLERFVSDCRASGICG
MIVPDLPMEESRPLREVTSRHGVDLINMIAPNTPDKRIRDIVSTSSGFVYLVARSGVTGA
RADLQESTKHLVERVPPVIPRAVGFGVSRPEHAAELVRAGADGVIVGSACVDLIGKKELD
QLEDLIRSMKKAISEVSVKSAASIHQS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactccgtctgatatgagcctgtacgaggtattcaggaggtgcagacctctcatcgtc
tacatctgcgccggtgacccctcccctgatgagaccgtggatatcgcggataggatagtg
cgcgcaggtgctgatgtgctcgagctcggccttccacactcagatccgatcgcggacggg
cccgtgatacaggccgcgtcacagagggcgatagccgctggcatgaacacagacctgtac
ttcgatgttgcatcgaaaatagatggtgtgccgaaggtattcatgggatactacaacatg
gtttatcggcgtggcctggagaggttcgtgtcagactgcagagcatctgggatctgtggg
atgattgtgccggatctgccgatggaggaatcgcgccccctccgagaggtgacaagccgc
catggcgtggatctcataaacatgatagctccgaacactcctgataaacgcatccgcgat
atcgtctccacgagctcaggttttgtgtacctcgtcgccagatcaggggtcacgggcgcg
cgcgcggatctgcaggagtcgacgaagcatcttgtagagagagtacctccagtcattcca
agagccgttggcttcggggtctcgaggccagagcatgctgccgagctcgtccgggccggc
gcagacggagtcatagtcggctccgcatgtgttgatctcattggtaaaaaagagcttgac
cagctcgaggatctgatcaggagcatgaagaaagcgatctctgaggtaagtgttaagtcc
gcagcatccatccaccaatcatga

DBGET integrated database retrieval system