KEGG   Methanosaeta thermophila: Mthe_0192Help
Entry
Mthe_0192         CDS       T00417                                 

Definition
tryptophan synthase, alpha subunit (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mthe_0192
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mthe_0192
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mthe_0192
Enzymes [BR:mtp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mthe_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(187117..187920)
Genome map
AA seq 267 aa AA seqDB search
MTPSDMSLYEVFRRCRPLIVYICAGDPSPDETVDIADRIVRAGADVLELGLPHSDPIADG
PVIQAASQRAIAAGMNTDLYFDVASKIDGVPKVFMGYYNMVYRRGLERFVSDCRASGICG
MIVPDLPMEESRPLREVTSRHGVDLINMIAPNTPDKRIRDIVSTSSGFVYLVARSGVTGA
RADLQESTKHLVERVPPVIPRAVGFGVSRPEHAAELVRAGADGVIVGSACVDLIGKKELD
QLEDLIRSMKKAISEVSVKSAASIHQS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactccgtctgatatgagcctgtacgaggtattcaggaggtgcagacctctcatcgtc
tacatctgcgccggtgacccctcccctgatgagaccgtggatatcgcggataggatagtg
cgcgcaggtgctgatgtgctcgagctcggccttccacactcagatccgatcgcggacggg
cccgtgatacaggccgcgtcacagagggcgatagccgctggcatgaacacagacctgtac
ttcgatgttgcatcgaaaatagatggtgtgccgaaggtattcatgggatactacaacatg
gtttatcggcgtggcctggagaggttcgtgtcagactgcagagcatctgggatctgtggg
atgattgtgccggatctgccgatggaggaatcgcgccccctccgagaggtgacaagccgc
catggcgtggatctcataaacatgatagctccgaacactcctgataaacgcatccgcgat
atcgtctccacgagctcaggttttgtgtacctcgtcgccagatcaggggtcacgggcgcg
cgcgcggatctgcaggagtcgacgaagcatcttgtagagagagtacctccagtcattcca
agagccgttggcttcggggtctcgaggccagagcatgctgccgagctcgtccgggccggc
gcagacggagtcatagtcggctccgcatgtgttgatctcattggtaaaaaagagcttgac
cagctcgaggatctgatcaggagcatgaagaaagcgatctctgaggtaagtgttaagtcc
gcagcatccatccaccaatcatga

DBGET integrated database retrieval system