KEGG   Methanosaeta thermophila: Mthe_0193Help
Entry
Mthe_0193         CDS       T00417                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mthe_0193
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mthe_0193
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mthe_0193
Enzymes [BR:mtp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mthe_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(187907..189091)
Genome map
AA seq 394 aa AA seqDB search
MDEISCEVRFGRYGGRFVPETLVQPLLELAEAFERLRADPGFSEELSRLMRDFAGRPTPL
YRAENLSRALGRTVYLKREDLLHGGAHKINNTLGQGLLAKYMKKRRLIAETGAGQHGVAT
AIVGALLGFETEIYMGELDIERQRMNVFRMELLGARVIPVKSGSRTLKDAINEALRDWAA
SYESTHYLLGTVAGPHPYPSMVREFQRVIGDETRSQILAEEKRLPDSIVACVGGGSNAMG
IFTSFLEDAVRLIAVEAGGRGSGRGARSAEHGASLALGEPGVLHGAMTKILQDPYGQILE
SYSIAAGLDYPGVGPELAHLAETGRVETAMASDETAIMGFKALSRLEGIIPALESAHAVG
FAIEHPEVLGELSVINISGRGDKDLHTVMAHDSV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatgagatatcctgcgaggtcaggttcggcagatatggtggcaggttcgttcccgag
acgctggtgcagccgcttctcgagcttgcagaggcgttcgagagactgcgagcggatcct
ggtttttcagaggagctctcaaggcttatgagagatttcgccggcaggccgactccgctc
tacagggctgagaatctgagcagagcgcttggaaggactgtgtacctcaagagggaggat
ctgcttcacggtggcgcgcacaagatcaacaacaccctcgggcagggactcctggcaaaa
tacatgaaaaagagaaggcttattgccgagactggcgccggccagcatggagtcgccaca
gcgatcgtgggcgcactgctgggattcgagacggagatatacatgggcgagttggacatc
gagcggcagcgcatgaacgtcttcagaatggaacttctgggcgccagagtcatacctgtt
aaatctggctcgagaacactgaaggacgcgataaacgaggcgctaagggactgggctgca
agttatgagagcactcactatctgctcggaacagtcgccgggcctcatccgtatccgtcg
atggtacgtgagttccagagggtgattggagacgagactagatcgcagatcctcgcggag
gagaagaggcttccagactcgatcgtcgcatgcgtcggcggaggatcgaatgcgatgggc
atattcacctcgttcctggaagatgctgtgagacttatcgcagtcgaggctggagggagg
ggctctggcaggggggcacggagcgcggagcacggagcatcgctcgcactgggggaacca
ggggtgcttcacggagcaatgacaaagatactgcaggatccatatggccagatactggag
tcgtactcgatagccgcgggcctggattatcccggtgttgggcctgagcttgcccatctc
gccgagacgggacgggtcgagacggcgatggcgagcgacgaaaccgcgatcatggggttc
aaggcactttccagactggagggcataatacccgcgcttgaatctgcacacgcggtaggc
tttgcgatagagcatcctgaggtgctgggggaactgagcgtgataaacatctccggcaga
ggcgacaaggatctgcacacggtgatggcccatgactccgtctga

DBGET integrated database retrieval system