KEGG   Methanosaeta thermophila: Mthe_0325Help
Entry
Mthe_0325         CDS       T00417                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mtp  Methanosaeta thermophila
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mthe_0325
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mthe_0325
Enzymes [BR:mtp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mthe_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
326083..327411
Genome map
AA seq 442 aa AA seqDB search
MQKRGRSRFPATALIRAHPHSPRVKTLNSVGIATYMSAADEMFDPEYMLDLLRDLIAFRT
VAPPGSFYHEIVDYLVPVLNDMGFATKKLVMPAEVFESKCTDPRLSGDRVNLIADMDLRR
PEWLVIYTHLDVVPPGDGWSTDPFSLTIRDGRAYGRGVSDSKGAVAAMIAALRGILRERK
PKYNLRLLLTTDEEVGGYSGLCYLADSGMVKGDKMLCMDGFSDDVVIGSNGIITWEVTVN
GRAAHSGSSFLGDNAIEKSLPVIDAILRHKREVEKKSSSLPASSVLRDKGIAHMMPILNI
NVIHGGIKENIVPDRCVFRGDRRVIPEERMEDAMSELEEIVKRFGSDIDIRMWPGYPPMR
MDPEHPWVLEVKEAVRRATGTEPHLSGTQGSLDQAYATEITKIPAAVYGVGRQLESNAHG
IDENVSVEDLVSYMRFVGELLL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagaggggaagatccagatttccggccacagctcttatccgggcacatccccac
tcccccagagttaaaactttaaacagcgtcggcatagcaacatacatgagcgcagctgac
gagatgttcgaccctgaatacatgctggatctcctcagagatctcatagccttcaggacg
gttgcaccacctgggagcttctaccatgagatagtggattacctcgtaccggtgctcaat
gatatgggatttgcgacgaagaagcttgtgatgcctgcagaggtcttcgagtcaaagtgc
accgatcccagactctcaggggatagagtcaacctgatcgcagatatggatctcaggagg
ccagagtggctagtgatatatacacacctcgacgtcgtacctccaggcgacggatggtcc
acagatccattctcgctcacgatcagggatggcagagcatacggcaggggagtctcggac
tcgaagggggctgtcgcggcgatgatcgccgccctcaggggcattctcagagaaagaaag
ccgaagtacaaccttcgcctgcttctgacgaccgatgaggaggttggcggctactccggg
ctgtgctatcttgcagattccggaatggtgaagggggacaagatgctctgcatggatggg
ttctccgatgatgttgtgatcggctcgaatggcattatcacatgggaggtcacggtgaat
gggagagcggcgcacagcggatccagctttctcggagataacgcgatcgagaagtcgctt
cctgtgatcgacgcaatactccgacacaagagggaggttgaaaagaaaagctcctcgctt
ccagccagctctgtgctaagggataaagggatcgcacacatgatgccgatattgaacata
aatgtgatacatggcggcattaaggagaacatagtccccgacagatgcgtcttccgagga
gacaggcgggtgatcccggaggagaggatggaggatgccatgagtgagcttgaggagata
gtcaaacgcttcggctccgacatcgacataagaatgtggcctgggtatcctcccatgagg
atggacccggagcatccgtgggttcttgaggtgaaggaggctgtgagaagagcaacggga
acggagcctcatctgtccgggacgcaggggagcctggaccaggcgtatgcaacagagatc
acaaagatccctgcagcggtctacggtgtcgggaggcagctcgagagcaatgcacatgga
atcgatgagaacgtgagtgtcgaggatctcgtgagctacatgcggttcgtcggggagctt
ctgctctag

DBGET integrated database retrieval system