KEGG   Methanosaeta thermophila: Mthe_0380Help
Entry
Mthe_0380         CDS       T00417                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mthe_0380
   01230 Biosynthesis of amino acids
    Mthe_0380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_0380
   00030 Pentose phosphate pathway
    Mthe_0380
   00051 Fructose and mannose metabolism
    Mthe_0380
  Energy metabolism
   00680 Methane metabolism
    Mthe_0380
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mthe_0380
Enzymes [BR:mtp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mthe_0380
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mthe_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
380584..381477
Genome map
AA seq 297 aa AA seqDB search
MDLNVPLDVPRNARDEYIRNYMEITRGSGRLMLFAGDQKVEHLNDDFYGPGISEDDADPE
HLFRIASRGRIGVFATQLGLIARYGMDYPEVPYLVKLNSKTNLVKTSQADPLSRAWLDVS
QVMEFRRESGLRILGVGYTVYPGSEHEVVMLREAAQVVHEAHRHGLVVVLWMYPRGKAVK
DERDPHLIAGACGVAAALGSDFVKVNYPKAENPALAFREAVMAAGRTKVICAGGSSEDPE
LFLQRLHEQIHISGASGNATGRNIHQKRLEDAIRMCNAIYAITVENRSLEEALRMLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggatctgaatgtgccacttgatgttccgagaaacgccagggatgagtacatcaggaac
tacatggagatcacgaggggttcgggcagactgatgctgtttgcaggcgatcagaaggtt
gagcatctgaacgacgacttctacggtccggggatatcagaggacgatgcggatccggag
catctcttcaggatagccagcaggggcaggatcggcgtttttgcgacgcagctaggcctg
atcgccagatatggcatggattatcctgaggtcccctatctggtcaagctgaactccaag
acgaatcttgtaaagacatcacaggcagatcccctgagcagggcgtggctggacgtctcg
caggtcatggagttcaggagggagagcgggctcaggatactgggtgtcggctacacggtc
tacccggggagcgagcacgaggttgtgatgctgagagaggcagctcaggtggtgcacgaa
gctcacaggcacggtcttgtcgtggttctgtggatgtatccgaggggcaaggctgtgaag
gacgagcgtgacccgcatctgatcgccggagcatgtggggttgcagccgcactgggaagc
gatttcgtgaaggtgaactaccccaaggcggagaatcccgctctcgcattcagggaggct
gtgatggcagcaggcagaacaaaggtgatatgcgctggcggatcgagcgaggatcctgag
ttattcctccagcggctccacgagcagatacacatctcaggtgcatccggaaacgccacg
ggcaggaacatacaccagaagcgcctcgaagatgcgatcaggatgtgcaacgcgatatac
gccataaccgtcgagaacagatctttggaggaggcgctgcgcatgctgcgctga

DBGET integrated database retrieval system