KEGG   Methanosaeta thermophila: Mthe_0449Help
Entry
Mthe_0449         CDS       T00417                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mtp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
464390..466399
Genome map
AA seq 669 aa AA seqDB search
MHHLKRRTIPFTSIVGQDLMKLALVLNAINPRIGGVLIRGDKGTAKSTAVRALADLLDEI
PVVDGCPFNCNPFSEDEMCDICYQKSQNGDLQVLMRRMPVVDLPLGATEDRVVGSLDVER
AIKEGIKALEPGILAAANRGILYIDEVNLLDDHVADVLLDAAAMGVNIVEREGVSVAHPS
RFMLVGTMNPEEGEIRPQLLDRFGLQVNVEVISDVDLRVEIAKRAERFESDPEAFISEWS
DEQNLLRERIRRAKQMLPGVVMDDSLLRLIARTCIEMGVRTHRAEIVTARTARTIAAFEG
RNDVTEEDVRRAMILALPHRMRSKPFEPPSMAQEKLEQAMAKHQEQKHQHKHQHEHHEER
RPQEESSDAPSEQSESTPEESVFGIGSPIDVKQLRDTLRRDRVLRRMPRGRRVSSLSMRR
SGRYLRSKLPVDGRDIAFDATIRAAAPHQHMRERRFAVTILPQDIREKERVRKTSATVLF
VVDASGSMGAMRRMESAKGAVLSLLMDSYQKRDRIGMVAFRGNDADLLLPPCSSVDLAMK
RLAELPTGGRTPLSAGLSKALRVIQGELIKNKETRPMIVLVSDGRANVSISSDPKKEIVQ
IAEEARRLGVHTVVIDTEVVGSSFMEMRLGYCRDIAEAAGGRYYPISDITPESLSRIVEQ
EHMGLFHGS
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatctcaagaggcgcacgattccgttcacatcaatcgttggccaggacctgatg
aagctggcccttgtgctcaatgccatcaacccgaggataggcggtgttctcatacgtgga
gacaagggcaccgccaaatcgactgcagttcgggccctcgcagatcttctcgatgagata
ccggtcgtcgatggctgcccgttcaactgcaacccattcagcgaggatgagatgtgcgat
atctgctatcagaagagccagaatggcgatctgcaggttctgatgaggagaatgcctgtg
gtggacctgccgctcggagccacagaggacagggttgtaggctctctggatgtggagcgc
gcgataaaggaggggataaaggcgctggagcctgggatactggctgcagcaaacaggggc
attttatacatagatgaggtgaaccttctcgacgaccatgtcgctgatgttcttctagat
gcagctgcaatgggggtgaacatcgtcgagagggagggggtgtcggttgcgcatccatcg
aggttcatgctcgtcggcaccatgaaccctgaggagggtgagatccgtccgcagcttctc
gaccgcttcggcctccaggtcaacgtcgaggttatctcagatgtcgatctcagagttgag
atcgcaaagagggccgaacgttttgaatccgatcctgaggcgttcatctcggagtggagc
gatgagcagaacctcctgcgcgagaggatccgcagggctaagcagatgcttccaggggtc
gtgatggacgattctctcctgaggctcatagcccggacatgcatcgagatgggggtcaga
actcacagggctgagatagtcactgccagaactgccaggacaatagctgcattcgagggc
aggaacgatgtcacggaggaggatgtgaggagggcgatgatcctggcgctgccccacagg
atgaggagcaagcccttcgagccgccatcgatggctcaggagaagctcgagcaggcgatg
gcaaaacaccaggagcagaagcatcagcacaaacaccagcatgagcatcatgaagagaga
cgtccgcaggaggaaagctctgatgcccccagcgagcagagcgaatccacgcctgaggag
agtgtattcgggataggctctccgattgacgtgaaacagctcagagatacactgaggcgc
gacagagtgctgaggaggatgcccagaggaagaagggtgagcagcctgagcatgcgcagg
tccggcagatacctgcgatcgaagctgccggtggacgggagagatatcgcattcgatgcc
acgatcagggcggccgcgccgcaccagcacatgcgcgagagaaggttcgcggtgaccatc
cttccccaggatatcagggagaaggagcgggtcagaaagacctcggccacggtgcttttc
gtggtcgatgctagcggctccatgggtgcgatgcgccggatggagagcgcaaagggcgct
gtcctctcgctcctcatggactcgtaccagaagagggacaggatagggatggtggcattc
agggggaatgatgcagatctcctcctcccgccgtgctccagtgtcgatctcgcaatgaag
agacttgcagagcttcccactggcggaaggacgccgctatccgcaggtctctcaaaggct
ctcagggtcatacagggtgagcttatcaagaacaaggagaccagacccatgatcgttctg
gtctcagatggaagagcgaatgtctcgatctcctcagatccgaagaaggagatcgttcag
atcgctgaggaggcgaggaggctcggtgttcacactgtggtcatagacacagaggtcgtg
ggatcttcattcatggagatgaggctcggatactgcagagacatcgcggaggcagccggc
ggcaggtactaccctatatccgatatcactcccgagtccctgagcaggatcgtggagcag
gagcacatgggcctcttccacggaagctga

DBGET integrated database retrieval system