KEGG   Methanosaeta thermophila: Mthe_0462Help
Entry
Mthe_0462         CDS       T00417                                 

Definition
(RefSeq) thymidine phosphorylase (EC:2.4.2.4)
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mtp  Methanosaeta thermophila
Brite
Enzymes [BR:mtp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mthe_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
478003..479541
Genome map
AA seq 512 aa AA seqDB search
MFEVVPFDIEIGQYKVMLNIADARAMGLNPGDRVRVRTRGASLTAILDVTGQMIGQGQVG
IFTEAFRDLKEAKSVEISPAPRPASISYIKMLMDRQKLSEDQIRSIVRDIVYNNLSEIEL
SAYITASYIHNLDPQETEWLTRAMIETGERIYFDKHPVVDKHSIGGVPGNKVSMLVVPIV
AASGLLIPKTSSRAITGAGGTADLMEVLAPVEFTADEIKEITETVGGVIAWGGATNIAPA
DDRLIKAEYALAIDPYSQMLASIMAKKGAVGADAVVVDMPTGPGTKLETPEKARVLAKDL
TDLGERLGIRVECAMTFGGSPVGRTVGPALEVREALKMLETGEGPNSLREKSLALAGILL
EMGGVAARGEGYRAAEEILVSGKAHRKLMEIVEAQGGDPKIRSEDIQIGEHQKQILSPTN
GYVVAFYNKRIIEIARAAGAPGDKRAGVIIHKKMGEIVKKGEPLLTICSSTDWELECAVK
MCSMRDALEQPPIVVEGMLLERYPTERYPRTI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggttgttcctttcgatatagagatcgggcagtacaaggtaatgctcaacatc
gcagacgccagagcgatgggcctcaacccgggagacagggttcgggtgagaacgagaggc
gcatctctgaccgcgattcttgacgtgactggacagatgatcgggcaggggcaggtcggc
atattcacagaggcgttcagggatctgaaggaggcgaagagcgtggagatatcgcccgcc
ccaaggcctgcctcgatatcatacataaagatgctgatggacaggcagaagctgagcgag
gatcagatcaggagcatagtgagggatatcgtctataacaacctcagcgagatcgagctc
tcagcctacatcacagcatcctacatccataacctggatccacaggagacggagtggctc
accagggcgatgatagagactggcgagaggatatacttcgataagcatcctgtcgtggac
aagcacagcataggtggggttccagggaacaaggtctcgatgctcgtggttccgattgtc
gcagcctcaggcctgctcataccgaagacaagctcgagggcgataacaggcgcaggcggg
accgcggatctgatggaggttcttgcgcccgttgagttcacagccgatgagatcaaggag
atcaccgaaaccgtgggaggggtcatcgcatggggcggcgccacaaacatagcgccggcg
gacgacaggttgataaaagcggagtacgccctcgccatcgatccctacagccagatgctc
gcctcgataatggcgaagaagggggcagtcggagctgacgctgtcgtggtcgatatgccc
acaggccctggaacgaagctggagacgccggagaaggcgagggtactcgcgaaagatctc
acagaccttggagagcggctggggatcagggtggagtgcgcgatgacctttggcggctct
cccgtcggtcgcacagtgggacctgctctcgaggtcagagaggctttaaagatgctggag
acaggcgaggggccgaacagcctcagagagaagagcctcgccctcgcaggcatactcctg
gagatgggaggggttgcggccaggggcgagggatacagagccgcggaggagatactggtg
agcggaaaggcccacaggaagctcatggagatcgtagaggcgcagggaggggatccgaag
ataaggagcgaggacatccagatcggagagcatcagaagcagatactctccccgacgaac
ggatacgtggtcgcattctacaacaagagaatcatagagatcgcgagggcagcaggcgcg
cccggtgacaagagggcgggagtgataatacacaagaagatgggagagatcgtgaagaag
ggtgagccgctgctcacgatatgctccagcacagactgggagctggagtgcgcggtgaag
atgtgctcgatgagggacgccttggagcagccgccgatagtcgtggagggcatgctgctc
gagaggtatccgaccgagaggtatccgagaacgatatga

DBGET integrated database retrieval system