KEGG   Methanosaeta thermophila: Mthe_0686Help
Entry
Mthe_0686         CDS       T00417                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mthe_0686
   01230 Biosynthesis of amino acids
    Mthe_0686
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_0686
   00030 Pentose phosphate pathway
    Mthe_0686
   00051 Fructose and mannose metabolism
    Mthe_0686
   00052 Galactose metabolism
    Mthe_0686
  Energy metabolism
   00680 Methane metabolism
    Mthe_0686
Enzymes [BR:mtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mthe_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
724526..725476
Genome map
AA seq 316 aa AA seqDB search
MIYTITLNPAIDRTMWVERIRDDEPNRIVREENYAGGKSIDVSKVLKNLGVESTALGFIG
GFAGMELEGRLLNEGIGTDFIRVSGETRTNIIIHEISTGRQLSFYAKGPDIRPHELVMLI
EQIEGLRDPEIVTIGGSLPPGLSPAVYRRIVTEAKKCEHNGCKAKVFLDVDGLSLRSSIE
AAPDVIKPNIYELSELVGRELREIDEVLAAAREINRKGVEVVLVSMGPRGIVLVSAHEEY
HAIPPQVKVENTVGAGDSSVAGFIYGMVNGKSLAECLIYAVAAGTATTLTEGTALANMED
FERLIPQITLRTLKTS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatatacacaatcacgctgaaccctgcaatagacagaacgatgtgggtcgaacgcatc
agggatgatgagcccaatagaatcgtaagagaggagaactacgccggcgggaagagtatc
gatgtatcaaaggtgctcaagaacctgggggttgagagcacagcgctcggcttcatcgga
ggatttgccggaatggagctggaggggaggctcctcaatgagggtatcggcacagacttc
atcagggtatctggggagacgagaacgaacataatcatccacgaaatctctacaggtcgg
cagctatcattctacgcgaagggtccggatatcaggccccacgagctcgtcatgctcatc
gagcagatagaagggctgagggatcctgagatcgtgacgatcggcggcagcctccctcca
ggcctgagccctgctgtttaccggaggattgtgacagaggcgaagaagtgcgagcataac
ggctgcaaggcaaaggtctttctggatgtcgatggcttatctctaagatccagcatagag
gcagctcctgatgttataaagccaaacatatacgagctcagcgagctggtgggcagggag
ctgagggagatcgatgaggttctcgctgcagcaagagagataaacagaaagggcgtggag
gtcgtgctcgtctccatgggacctcgcgggatagttcttgtatcagcccacgaggagtat
cacgcgatcccaccacaggtcaaggttgagaacacagtgggcgctggagattcatcagtc
gctggcttcatctacggcatggtcaatggaaagtcactggccgagtgtctgatctatgcg
gtggcggcaggcacagcaacgacccttacagagggcacggctctcgcaaatatggaggac
ttcgagcggctgatccctcagataacgctcaggaccctgaaaacatcttga

DBGET integrated database retrieval system