KEGG   Methanosaeta thermophila: Mthe_0701Help
Entry
Mthe_0701         CDS       T00417                                 

Definition
hypothetical protein
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:mtp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(738653..739807)
Genome map
AA seq 384 aa AA seqDB search
MNKNAGFVGFDGTESKRTIFALHAVKQAAGISGDINVLVRKPHARAVSMLRKMIRICGVR
AYASNDEDRAKWESAGFKLEGGYRDFFESSEFVMIGTPGDEELPYLKSGLEHGCFVALMG
GAHRDKLQKGLEEEGFQLTDDVKEDLRREFFFGLENYERFLKAKPRVVQCTSCNTTGLSR
LAYAARPLGLCGIIGNIDRRHGDPHTVVRASPSAIQFGRGAGHQGADAGTIFKDVRFSIR
ASKVPTTIPHTNFLNLIFKGQLTPQDLVERLASTREVVVIPYQDAGGRRHEWTSEILEAF
LSGFERPISPEIFELLVSDAIIPFELGDYTIMQTVSMVEQMSIAVPNHVEAYMLSCGYPA
ADVHETVDRAIGVVHGVWPDKLSI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagaatgctggctttgtgggttttgatggcacggagagcaagagaacaattttc
gccctgcatgctgttaagcaggcagccggcatcagtggcgatataaatgttctcgtgaga
aaaccgcatgccagagccgtatcgatgctgaggaagatgatcaggatctgcggtgtcagg
gcgtatgccagcaatgacgaggacagggcaaaatgggagagtgcagggttcaagctggag
ggaggatacagggatttcttcgagagctctgagttcgtcatgattggcacacctggtgat
gaggagctgccatacctgaaatccgggctggagcacggctgcttcgtagcacttatgggc
ggggcccacagggataagctccagaaggggctcgaggaggaggggttccagctcacagat
gatgtgaaggaggatctaaggagagagtttttcttcgggcttgagaactacgagaggttt
ctgaaggcgaagccaagggtcgtgcagtgcaccagctgcaacacgacaggcctgagcagg
cttgcatatgctgcgcgcccactcgggctctgcggcataattgggaatatcgacaggaga
catggagatccgcacacagtcgtgcgcgcatcgccgagtgccatacagttcggaaggggt
gcaggtcatcagggcgcggacgcgggcacaatcttcaaggatgtaaggttctcgatacgc
gcctcgaaggtgccgacgacgataccacatacgaattttctcaatttgatattcaagggg
caattgacaccacaggatctcgtcgagaggctcgccagcacgcgtgaggttgtcgtgata
ccctatcaggacgcgggcggaaggcgtcatgagtggacgagcgagatactcgaggcgttc
ctgtcaggctttgagaggccgatctctccagagatatttgagcttctcgtgtcagatgcg
ataatacccttcgaactcggcgattacacgatcatgcagactgtctcgatggtcgagcag
atgtcgatcgctgtgcccaaccacgtggaagcgtacatgctctcctgcggatatcccgct
gctgatgttcatgagacggtagacagagccatcggagtggtccatggcgtatggcctgac
aagctgagcatctga

DBGET integrated database retrieval system