KEGG   Methanosaeta thermophila: Mthe_0898Help
Entry
Mthe_0898         CDS       T00417                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mtp  Methanosaeta thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
974555..976093
Genome map
AA seq 512 aa AA seqDB search
MYRDLRDIVDAIASGIIRSEEDLEKAKRAFAATLNLSEIPGNSEILAAARPEERARLKLL
VKKPTRTLSGVAVIAVMTSPARCPHGICIPCPGGVLGERCSPQSYTGREPAALRAVQHNF
DPYAQVAARLKQLSEIGHPVDKAELILMGGTITSRPLGYQCWFVRRCLEAMNDYPDTRRS
TRWRSFREVADANTSAAVRNVGITFETRPDWCRENHIKNMLLLGATKVELGVQSIYDDVL
SAIRRGHSVEETIRANRLLREAGLKVGFHMMPGLPGSDPDRDLKMFRELFESSNYRPDYL
KIYPTLVIEGTELHRMWIRGDYEPLSDDEAAELISRIKEILPRYTRLQRVQRDIPAHLIT
AGVRKSNLRQLARKRLEERGLRCSCIRCREAGLRGVSEGDLSMNIESYDACGAKEHFISF
DTVDDTLVGFLRLRLGAEARIRELHVYGPLVPLGRRGGWQHRGIGARLIERAEEMARDQG
YERISVTSGIGVRGYYASLGYRLNAPYMEKTL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtacagggatctcagggatatcgtggatgcgatcgcatccggtattatcagaagcgag
gaggatctcgaaaaagcgaaacgggcatttgcagccactttgaatctctcagagataccg
ggcaactctgagatactcgctgcagccaggccggaggagagggcccggttaaagctgttg
gtcaaaaagccgacccgcacgctctcaggagtagctgtgatagctgtcatgacgagcccg
gcgcgctgccctcatgggatctgcatcccatgccccggaggcgttctgggcgagagatgt
tcaccgcagagctacacgggaagagagcctgcggcgctgagagcggtacagcataacttt
gatccctacgcacaggtggctgcgaggctcaaacagctctcagagataggtcaccctgtc
gacaaggcagagctcattctcatgggagggaccatcacatccagacccctcgggtatcag
tgttggtttgtgaggagatgcctggaggcgatgaacgattatcctgacacgaggagaagc
acacgctggagatccttcagagaggtggcagatgcaaacaccagtgcagcggtgagaaac
gtcggcataaccttcgagaccaggcctgactggtgccgtgagaatcacatcaaaaacatg
cttctcctcggggcgacgaaggtcgagctgggagtgcagagcatctacgatgatgtcctc
agtgcgatcaggagaggccattctgtggaggagacgataagagcaaaccgtttgttgaga
gaggccgggctgaaggtcgggttccacatgatgcccgggcttccgggatctgaccctgat
agagatcttaagatgttcagggagcttttcgagagcagcaattaccggccggattacctc
aagatataccccacgcttgtgatcgaggggacggagctccacaggatgtggatacgggga
gattatgagccgctttcggatgatgaggctgctgagttgatatcgcgcatcaaggagatc
ctcccgaggtacacaaggctccagcgcgtgcagagagatatacccgcgcatctcataact
gctggcgtcaggaagagcaacctcaggcagctcgccagaaagagacttgaggaacgcggt
ttgaggtgcagttgcataagatgcagagaggccgggcttcgtggtgtatctgagggggat
ctctcgatgaacattgagagctatgatgcatgtggagcaaaggagcacttcatatcgttt
gataccgtggacgacaccctcgtcggattcctcagactcaggctgggcgctgaggccagg
atcagggagctgcacgtctacggccctctcgttcctctcggaagaaggggcggatggcag
catcgcggcatcggcgcgaggctcatagagagggcggaggagatggcgagggatcaggga
tacgagaggatctcggtcacgagtggtataggcgtcaggggctactatgcatctctgggc
tacaggctgaacgcgccgtacatggagaagacgctctga

DBGET integrated database retrieval system