KEGG   Methanosaeta thermophila: Mthe_0934Help
Entry
Mthe_0934         CDS       T00417                                 

Definition
(GenBank) peptidase M42 family protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1018275..1019324)
Genome map
AA seq 349 aa AA seqDB search
MRSLLERLSNAHGISGREGSVMQIIRDELAPHVDDVQIDTLGNLVATRRGKSPSVMIAAH
ADEIGLMVKFVDEKGFVYFVKIGGWFDQTLLNQRVILHTKNGPVFGVIGSKPPHVMKEED
RKKPVDSRDMFIDVGARDQNEAREMGIVPGVPITIDRSFVPLRGDRVTGKAFDNRAGVAM
MIEAMKRTRTECTVYAVSTVMEEVGLKGAKTCAFGIRPDLAIVTDTTIPGDHPGIEKKDS
ALEMGKGPVITVVDASGRGLIADEDVLDWLQKTAEQFSIPVQLDVSGGGTTDATAIQLSR
EGVKTGVVSIATRYIHSPVEVLSLEDLDKGAELIARALETAPRYFRREG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagatctttgcttgagaggctcagcaacgcccatggaatctcagggagagaagggagc
gtgatgcagatcataagagatgagctcgctccccacgttgatgatgttcaaatagacacg
ctgggaaatctggtcgcgaccagaaggggcaagagcccctcggtgatgatagcagcacac
gccgatgagatcggtctgatggtcaagttcgttgatgagaagggattcgtctactttgtg
aagatcggcggctggttcgaccagacgcttctgaatcagagggtgatacttcacacaaag
aacggccccgtattcggcgtcataggctccaagccaccgcatgtgatgaaggaggaggac
aggaagaagccagtcgattccagagatatgttcatagatgtcggggctagggaccagaac
gaggcgagggagatggggatcgttcctggggtgccgataaccatcgacaggtcatttgtt
ccgctcagaggggacagggtcactggaaaggcgtttgacaaccgcgctggcgtggctatg
atgatagaggcgatgaagagaaccaggactgagtgtacggtctacgcggtcagcactgtg
atggaggaggtcggcctgaagggtgcgaagacgtgcgcgttcggcatcaggcctgatctt
gcaatagtcactgacacgacgattccaggggatcaccctgggatagagaagaaggattcg
gctctcgagatggggaaggggccggtcataacagtcgtggacgcatccggacgcgggctg
atagcagatgaggatgtgctcgattggcttcaaaagaccgctgagcagttcagcataccg
gtacagctcgatgtctcaggtggagggacgacagatgcgaccgcgatccagctctcgaga
gagggtgtcaagaccggagttgtgagcatcgccacgaggtacatccactcgcccgtggag
gtcctgagcctggaggatctagataaaggggcggagctgatcgccagggcgctcgagacc
gcccctagatacttcagacgggaaggttaa

DBGET integrated database retrieval system