KEGG   Methanosaeta thermophila: Mthe_1080Help
Entry
Mthe_1080         CDS       T00417                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mtp  Methanosaeta thermophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mthe_1080
   00052 Galactose metabolism
    Mthe_1080
   00500 Starch and sucrose metabolism
    Mthe_1080
   00520 Amino sugar and nucleotide sugar metabolism
    Mthe_1080
Enzymes [BR:mtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mthe_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1170052..1170966)
Genome map
AA seq 304 aa AA seqDB search
MTERGYAGDGGGILGNPEIRKAVIPAAGQGTRFLPITRAQPKEMLPVVDKPVIQYVVEEA
ISSGIEDILIITGRGKRAIEDHFDVSCELEKTLLQKNDAKLYDQYRRISDLADIHYIRQK
EPRGLGDAILHAERHCDGEPFAVLLGDTITVPYNGSEPCTSQMIKFYKKYHSTIVAVERV
PKNKIQDYGIIDGTLLEDGVYKITDIVEKPSPEVAPSDLGAIGRYILMPEIFDILRTIKP
GHGGEIQLTDALKCCGDAIGLVTRCRRYDIGDKISWMKSSLELALARDEFADELRRFMKS
LLKE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaggggatatgctggtgacggagggggtatattgggaaatcctgaaatcagg
aaagcggtgatacctgcagccggccagggtacgagatttcttccaataaccagagcacag
ccgaaggagatgctgcctgttgtggataagccggtcatacagtatgtggtagaggaggcg
atatcctcaggaatagaggatatcctgataataaccggccgtggcaaaagggcaattgaa
gatcactttgacgtatcctgcgagctggaaaaaaccttgctgcagaagaatgatgccaag
ctctacgaccagtacagaagaatttcagatcttgcagatatacattatatccggcagaaa
gagccgagaggactaggagatgcaattctgcatgcagagaggcactgtgatggtgagccc
ttcgcagttttgctgggtgacacgataacagttccatataacggttcagagccgtgtacc
tcccagatgataaagttttacaaaaagtatcacagcaccattgtggctgtggaaagagtt
ccgaaaaataaaatacaggactacggcataattgatggtacgctcttggaggatggcgtc
tacaagataactgatatagtggagaaaccatcgccggaggtggctccatcagacctcgga
gcaatcggcagatacatacttatgccagagatattcgatatcctcaggactattaagccc
ggacatggtggcgagatacagctcaccgatgctctaaagtgctgtggtgatgcaattggg
ctggtcacacgttgccgtcgttatgacataggcgacaagatcagctggatgaagtccagc
ctggaactggccctcgccagagatgagtttgcagatgagctcaggagattcatgaagtct
cttttgaaagaataa

DBGET integrated database retrieval system