KEGG   Methanosaeta thermophila: Mthe_1118Help
Entry
Mthe_1118         CDS       T00417                                 

Definition
alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mtp  Methanosaeta thermophila
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mthe_1118
Enzymes [BR:mtp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Mthe_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1205056..1205934)
Genome map
AA seq 292 aa AA seqDB search
MKSLGIVVSNPDDWTARAISMGLAELGASAVMMDISELAVEIGFDLSFRKGGVDLFDLDT
LIIRDMGRGAPQDVAFRFEALRSLADLGVTVINPPDAIVRAANKFATSMALRRAGVPTPR
TVVTSSYDEALKTVERMGRAVCKPLFGYKGKDIALLRPGDADLIKDLLIRRGALYLQEFI
ETPEKRDIRAFVVGEEVAGAIYRVAPPGEWISNLARGGRAERCEISDEIERIAVDANRAV
GTMYSGVDMLESEDGMMVIEVNGTPSGKGIYSALGVNVGRTIAGLALGVPMR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgcttggtatcgtggtctcgaatccggacgactggaccgccagggcgatatcc
atgggcctggcagaactcggcgcctctgcggtgatgatggatatctcagagcttgcggtc
gagatcgggtttgatctgagcttcaggaagggaggcgtggatcttttcgatctcgacacg
ctcataatcagagacatgggcaggggcgcgccacaggatgttgcattcaggtttgaggcg
ctcaggtcgcttgcagatctcggagtgaccgtgataaatcctccggatgcgattgtgaga
gctgcgaacaagtttgcaacatccatggcgctcaggcgtgcaggtgttccaacacccagg
acagttgtgacttccagctacgatgaggctttaaagactgtggagaggatggggcgtgcg
gtctgcaagccgctcttcgggtacaagggaaaggatatagcgctactccggcctggggac
gcggatctcataaaagatcttctcatcagaagaggcgccctctacctccaggagttcatt
gagacgcctgagaagagagacatacgggcatttgttgttggggaggaggttgctggcgcc
atatacagggtcgcgccaccaggcgaatggataagcaatctcgcacgtggcgggagagcg
gagaggtgcgagatcagcgatgagatagagagaatcgcggtagatgcaaacagggcggtc
gggaccatgtacagcggagtcgacatgctcgaatcagaagatggaatgatggtgatcgag
gtcaacgggaccccgtctggaaagggtatatactcagcgctcggcgtgaatgtgggacga
acgatcgcggggcttgcgcttggagtaccaatgcgctaa

DBGET integrated database retrieval system