KEGG   Methanosaeta thermophila: Mthe_1195Help
Entry
Mthe_1195         CDS       T00417                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mthe_1195
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_1195
   00620 Pyruvate metabolism
    Mthe_1195
   00640 Propanoate metabolism
    Mthe_1195
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1195
   00680 Methane metabolism
    Mthe_1195
Enzymes [BR:mtp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mthe_1195
Lipid biosynthesis proteins [BR:mtp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mthe_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1286814..1288826)
Genome map
AA seq 670 aa AA seqDB search
MTVEECHKMAEEKAATTAVLLEETRVFHPPKELAENSNVMQWMKKKGFTSEREMRAWTGQ
HYIEFWDEMAKTYADWFEPYAQILEWKPPYARWFVGGKCNVAYNAVDRHAKGAKKDKVAY
IFVPEPTDQQVRKITYLDLYKAVNKFANGLKSLGVKKGDRVSIYMPMIPETPIAMLACAK
IGAIHSVVFSGFSAGGLQSRVLDAEAKVVVTTDGFYRRGKPLPLKPNVDEAVQNAPSVEK
VVVVKRAGLDVPMKEGRDIWYHELVANQPDECETEKMDSEDRLFILYTSGTTGKPKGIEH
VHGGYCVTPAQTTHWVFDLKDDDVWWCTADVGWITGHSYVVYGPLCLGATSILYEGAPDY
PDFGRWFSIIQEHKVSVFYTAPTAIRMFMKAGEQWPQKYDLSSLRLLGSVGEPINPEAWI
WYRKYFGSDRCPIMDTWWQTETGCFVVSPLPITPLKPGSPTFPLPGFNTDIYDEDANPVP
PGQGGNIVNPTPWPSMLRAFYKDPERYMKEYWQMYWDIRPGVYLAGDKATRDKDGYFFIQ
GRIDDVLKVAGHRISNAEVESALVSHPAVAEAAVIGKPDEVKGEVIVAFVILREGVKESE
DLKKELAKHVRSVLGPVAYPEIVYFVKDVPKTRSGKIMRRVIKAKALGNPVGDISALANP
EAVDAIPLIK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgaggagtgtcacaaaatggctgaggaaaaagctgctacaactgcggttctt
cttgaggaaacaagagtgttccatccccctaaggagcttgctgagaactcaaatgtcatg
cagtggatgaagaagaagggattcacaagcgagcgggagatgcgcgcctggaccggccag
cactacatagagttctgggacgagatggccaagacctacgcggactggttcgagccatac
gcgcagatcctcgagtggaagccgccgtatgcgagatggttcgttggtgggaagtgcaac
gtcgcgtacaacgctgtggacagacatgcaaagggcgcaaagaaggacaaggtcgcctat
atcttcgtgcccgagccgacagatcagcaggtgaggaagataacctacctggatctgtac
aaggctgttaacaaattcgcaaacggcctgaagagtcttggtgtgaagaagggcgacagg
gtcagcatatacatgcccatgatcccggagacgccgatagcgatgctcgcatgtgcgaag
atcggcgcgatccacagcgtggtattctccggattcagcgctggaggcctccagagcagg
gttctcgatgcagaggcgaaggttgtcgtcacaaccgatggattctacaggcgcggcaag
ccgctcccgctcaagccgaacgtcgatgaggcagtccagaacgccccgagcgttgagaag
gtcgtcgtggtcaagagggcagggcttgacgtcccgatgaaggagggccgtgatatctgg
tatcacgagctcgtggccaatcagcctgacgagtgcgagacagagaagatggactctgag
gatagactgttcatcctctacacatcaggcacgacaggaaagccaaaaggcatcgagcac
gtccatggcggctactgcgtgactccggcacaaacaactcactgggtattcgatctcaag
gacgacgatgtctggtggtgcacagccgatgtcggatggatcacgggccactcctacgtc
gtttacggcccactctgtctgggcgcgacgagcatcctctacgagggcgcccctgactat
ccagacttcgggagatggttcagcataatccaggagcacaaggtctctgtcttctacaca
gcgccaacagccataagaatgttcatgaaggccggcgagcagtggccgcagaagtacgat
ctctccagcctgagactgctcggctctgtcggtgagccgatcaaccccgaggcctggata
tggtacagaaagtacttcggaagcgacaggtgcccgatcatggatacatggtggcagacg
gagactggatgcttcgtggtctctccattgccgatcacaccgctcaagcccggctcgccc
acattcccgctgcccgggttcaacacagacatctacgatgaggacgcaaacccagtgcct
ccaggacagggcggcaacatagtcaacccgacgccatggccgtcgatgctccgcgccttc
tacaaggatccagagaggtacatgaaggagtattggcagatgtactgggatatcaggcct
ggagtctacctggcgggcgataaggcgacgagggacaaggacggctacttcttcatccag
ggcaggattgatgatgtgttgaaggtagcgggccacaggatcagcaacgctgaggttgag
tcggcgctcgtgtcacatccggcggtcgctgaggcagcagtcatcggcaagcccgacgag
gtcaagggcgaggtcatcgtggccttcgtcatactcagagagggtgtgaaggagagcgag
gatctcaagaaggaactggcaaagcacgtcaggagcgtgctcgggcctgtcgcatatccg
gagatcgtctacttcgtcaaggacgtcccgaagacaagatccggaaagatcatgcgccgg
gtcataaaggccaaggccctgggcaatccagttggagacatctctgcgcttgcgaacccg
gaggctgtggacgccataccgctcatcaagtga

DBGET integrated database retrieval system