KEGG   Methanosaeta thermophila: Mthe_1277Help
Entry
Mthe_1277         CDS       T00417                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00260  Glycine, serine and threonine metabolism
mtp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01130  Biosynthesis of antibiotics
mtp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mthe_1277
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mthe_1277
Enzymes [BR:mtp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mthe_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABK15055
JGI: Mthe1277
UniProt: A0B8N1
Position
complement(1384212..1385564)
Genome map
AA seq 450 aa AA seqDB search
MRSKILLDEEEIPKRWYNVAADMPRPLDPPLNPATHEPLKPEDLEPIFPRSLIKQEMSTE
RWIDIPEEVRDVYRLWRPTPLYRAVRLEKALKTPARIYYKYEGVSPAGSHKPNTAVPQAY
YNMKEGIERIATETGAGQWGSALALATCIFGLKCTIYMVRSSYDQKPYRRSMMRVWGAEC
FPSPSNRTNAGRRILEQFPDTPGSLGIAISEAVEDAATHDDTNYALGSVLNHVLLHQTVE
GLEVKKQFELVDDYPDVIYGCCGGGSNFPGVCFPFIPDKLNDKKELRLVACEPTACPSLT
KGLYTYDFGDTARLTPLLKMYTLGHDFVPPGIHAGGLRYHGDAPLLCSLVNAGIIEAQAF
HQREVFDAATTFARAEGIVPAPESAHAIKPAIDEAIQCRKTGETKTLLINLSGHGHFDLS
AYDAYNDGILEDYEYPEELVRQSLARLPKV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgagatccaagatactgctcgatgaggaggagatcccgaagagatggtataatgtggcg
gcagatatgcccagacctcttgacccgccgctgaaccctgcgactcatgagccgctgaag
cccgaggacctcgagccgatatttccgagatcccttataaagcaggagatgagcacagag
agatggatagacattcccgaggaggtgagggacgtctacagactctggcgcccgacacct
ctgtacagggctgtcaggcttgagaaggccctcaaaacacctgccaggatctactacaag
tacgagggagtgagccctgcgggaagccacaaaccgaacactgctgtgccccaggcttac
tacaacatgaaggagggcatagagaggatagccacagagacaggggcaggacagtggggc
tcggcgctcgcgcttgccacatgcatcttcggcctgaaatgcacgatctacatggtccgc
tctagctacgaccagaagccataccgcaggagcatgatgcgggtctggggtgcggagtgc
ttcccgagcccgagcaacaggacgaacgctggcaggcgaatcctggaacagttcccggac
acgcctggcagccttggaatagcgatatcagaggctgttgaggatgcggccacgcatgat
gatacgaactacgccctcggatccgttctgaaccacgtgctccttcaccagaccgtcgag
ggtcttgaggtcaagaagcagttcgagctcgtggacgattacccggatgtgatatacggc
tgctgtggcggggggagcaacttcccgggagtgtgcttcccgttcatccctgacaagctc
aatgacaagaaggagctcaggcttgtggcgtgtgagccgacggcgtgccccagcctcacc
aagggtctgtacacgtacgacttcggagatactgcgcgcctgacgccgctgctcaagatg
tacacgctcggccatgacttcgtgccgcccgggatacatgcaggcgggctgaggtaccac
ggggatgcgcccctgctctgcagcctggtgaacgctggaatcatcgaggcccaggctttc
caccagcgagaggtcttcgatgccgcgacgaccttcgcgcgcgcagagggcatcgtcccg
gcgccggagtcagcgcatgcaatcaagcccgcgatcgacgaggcgatccaatgcaggaag
acgggagagacgaagacgctgctcataaacctgagcggccatgggcacttcgatctatct
gcgtacgatgcgtacaacgatgggatcctcgaggattatgagtatccagaggagctggtg
aggcaatcgcttgccaggctgccgaaggtgtaa

DBGET integrated database retrieval system