KEGG   Methanosaeta thermophila: Mthe_1305Help
Entry
Mthe_1305         CDS       T00417                                 

Definition
(GenBank) orotate phosphoribosyltransferase
  KO
K00762  
orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
mtp  Methanosaeta thermophila
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mthe_1305
Enzymes [BR:mtp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     Mthe_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1411852..1412415)
Genome map
AA seq 187 aa AA seqDB search
MSELREQLLSLIKEMALEIGTVVLSSGRTSDYYVDLRRIVLTPRGAYLTARLLLDLVRPE
VSAIGGMTLGADPIVSSMIVVGHMEGRDLCGLIVRKKAKRHGKRRFIEGPLMEAGAKVAV
VDDVVTTGNSLLRSIERLEEAGYTPIQTLAVLDRMEGGREALSAAGFELESLFTRDDLGI
APRDHSM
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagctcagggagcagcttctcagcttgataaaagagatggcgctggagatcggc
acagtcgtcctctcatccggccgcaccagtgactactacgtcgatctcaggaggatagtt
ctcactccgagaggggcgtatctgacagccaggcttctcctagatctcgtgaggcctgag
gtcagtgctatcggcgggatgacgctcggagcggatccgatcgtctcctccatgattgtg
gtcggccatatggaggggagggatctctgcggcctgatcgtgagaaagaaggcgaagcgg
cacggcaagaggaggttcattgaggggccattgatggaggcgggcgcaaaggttgcggtt
gtcgatgatgtcgtcaccacaggcaattcactgctcagatcgatcgagcggctcgaggag
gcgggttacacccctatacaaacacttgcagtcctggacaggatggagggagggcgggag
gccctatcggcggcgggattcgagctcgaatctctattcacgagagacgacctggggatc
gccccacgcgatcactccatgtag

DBGET integrated database retrieval system