KEGG   Methanosaeta thermophila: Mthe_1339Help
Entry
Mthe_1339         CDS       T00417                                 

Definition
(GenBank) assimilatory nitrate reductase (NADH) alpha subunit apoprotein
  KO
K00123  
formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
mtp  Methanosaeta thermophila
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mthe_1339
  Energy metabolism
   00680 Methane metabolism
    Mthe_1339
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     Mthe_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1442311..1444299)
Genome map
AA seq 662 aa AA seqDB search
MSGRTPTVCPYCAVGCGFYITRNGMEYMPDHPVNEGALCAKGNAALDILNHVERLRYPMM
RVGKDWIRVSWDEALDRVAEEMEKVLRERGPKALAFLGSAKCTNEENYIFQKIARLMGTN
NIDNCARRCHSPTIIALREMLGTPAMTNPISDLALSDCILVIGSNLAENHPVVARWILRA
KDRGAVVIVADPRVTPTSWLADLHMQLNPGTDIALINGMINVILREGLEKRAFINERTIG
FENLDLRDYTPERVSAITGLSAGDIIRAARLYARSPASSIVYCMGITQHTCGTDNVAACA
NLALVCGQIGRPGAGIFPLRGQNNVQGACDMGALADFYPGWRSVEDSRAIDDLRRLWNAR
SLPMGRGLTADLMPDADLKFLYVMGEDIVNSDPTVSRRRLKRGFMVVQDIFMTDTAKLAD
LVLPATAWAEKEGTITSTERRVQWIYRAGEPPGEARMDLWILSEVAARIGFDLASEPDEV
LAEINQAVPAYRGISRSNAGARGGIIWPCPHKDHPGTPLLHRERFSTPDGKARIIPVHHP
ALERTSTEYPLILITGRVALHYNSGSMTMRSEGLVKREPEIHIDVNPDDAMRFGLADGDA
VMVETRWGRARARAQITQGQKRGTLFMPFHFPETNLIASELLDRKAMMPELKVAACRIRR
CD
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaggacacccacagtctgcccctactgcgctgtgggctgcgggttttacata
acccggaacggcatggagtacatgcccgaccaccctgtcaatgagggggctctctgcgcg
aagggtaatgcagcccttgatatcctgaatcacgtggagaggctgcggtatccgatgatg
agggtcggaaaggactggataagagtatcctgggacgaggcgcttgacagagtggcagag
gagatggagaaggttctgcgggagagagggccgaaggcccttgcattcctaggatccgca
aaatgcaccaacgaggagaactatattttccagaagatcgcgcgactgatggggacgaac
aacatcgataactgcgcaagacgctgccactcgccgacgatcatcgcgctgcgcgagatg
ctcggaacccccgcgatgaccaatccaatatcagatctagcgctctctgattgcattctg
gtgatcggatcgaacctggctgagaaccatcctgtggtagccaggtggatcctgagagcg
aaggacaggggcgcggttgtgatcgtagcagatccgagggtgacaccaacctcctggctc
gcagatctccacatgcagctcaaccctggcacagatatcgcgctcatcaacggcatgatc
aacgtaatactaagagaggggctggagaaaagggcattcataaatgagagaaccattgga
ttcgagaatctcgatctcagagattacacccctgagagggtatccgcgataacaggcctg
agtgctggagatatcatcagagccgcgaggctatatgcgagatctcctgcatcttcaata
gtttactgcatgggcatcacacagcacacatgcggaacagataatgtggctgcatgcgcg
aacctcgccctcgtctgcggacagattggaagacctggcgccggtatatttccgctgagg
gggcagaacaacgtccagggagcgtgcgacatgggggctctggcggatttctatcccgga
tggagatctgtggaagattccagggcgatcgatgatctcaggcgtttatggaatgcgaga
tcccttccgatggggcgcggacttaccgctgatctgatgccagacgcggatctcaagttc
ctctacgtgatgggcgaggatatcgtgaactcagatcccactgtatcccggaggaggttg
aagagaggtttcatggtcgtgcaggacatattcatgaccgacaccgcaaagcttgcggat
cttgtgctgccagcgactgcatgggcggagaaggaaggcacaatcacatcaacagagcgg
agggtccagtggatatatcgagcaggagagcctcccggggaagcgaggatggatctgtgg
attctatcagaggtggcggcacgcatcggattcgatctcgcatccgaaccggatgaggtt
ctggcggagataaaccaggcggttccagcataccgcggcatcagcaggagcaatgcagga
gctcgtggcgggatcatctggccgtgcccgcataaggatcatcccgggactcctctgctt
cacagggagaggttctccactccggatggaaaagcgagaatcattccagtccatcaccca
gcgcttgagcgcacatccacagagtacccgttgatccttatcacagggcgtgtggctctc
cactacaactcaggatcgatgaccatgagaagtgaagggcttgtgaaacgagagccggag
attcacatcgatgtgaatccagatgacgctatgcgtttcggattagctgatggtgatgcc
gtcatggtcgagactagatggggcagagcaagggcgcgagcacagatcactcaaggacag
aagcgcgggacactgttcatgccattccacttcccggagacgaacctgatcgcatcagag
cttctcgacaggaaagctatgatgcccgagctcaaggtcgccgcgtgcaggatcaggagg
tgtgattga

DBGET integrated database retrieval system