KEGG   Methanosaeta thermophila: Mthe_1366Help
Entry
Mthe_1366         CDS       T00417                                 

Definition
(GenBank) ribonuclease P protein subunit Rpp14
  KO
K03537  ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5]
Organism
mtp  Methanosaeta thermophila
Brite
Enzymes [BR:mtp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Mthe_1366
Ribosome biogenesis [BR:mtp03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Mthe_1366
Transfer RNA biogenesis [BR:mtp03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Mthe_1366
Mitochondrial biogenesis [BR:mtp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Mthe_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_P_Rpp14
Motif
Other DBs
NCBI-ProteinID: ABK15141
JGI: Mthe1366
UniProt: A0B8W7
Position
complement(1461927..1462451)
Genome map
AA seq 174 aa AA seqDB search
MRSRLPVMRDRRRYLVFELESEGHLDARDVSIEIQSSYLSLFGDSGGASPRLISFDGRFG
IVRCRNGHVEELRASLATIHAIAGFRAAIRIRGVSGTIKTATEKYIPQSSIKPEEHRRRV
DLKGISGVIVSTRGHEIDVSPDDHIEGLDTRYLGLTYFDLEGGCDYADGTSDGV
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttgaggagcagactgccggtgatgcgggacaggcggcgttatttggtcttcgagcttgag
tccgaggggcatctcgatgccagggatgtctcgatcgagattcagtcctcctacctgagc
ctcttcggggattcaggaggcgccagccccaggctaatatctttcgacgggcgctttggc
atagtgaggtgcagaaatggtcatgtggaggagctgagagcatctcttgcaaccattcat
gcaatcgcaggattccgggctgcgatacggatccgtggcgtctccgggacgatcaaaacc
gccacagaaaagtatataccgcaatctagcataaaaccggaggagcatcggagaagagta
gacctaaagggaatttctggagtgattgtgagcacccgcggtcatgagatcgatgtatct
ccggatgaccatatagagggtctggataccagatatctgggtcttacatattttgacttg
gaaggaggatgtgattatgcagatggcacctcagatggggtatga

DBGET integrated database retrieval system