KEGG   Methanosaeta thermophila: Mthe_1370Help
Entry
Mthe_1370         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_lrg
Motif
Other DBs
NCBI-ProteinID: ABK15145
JGI: Mthe1370
UniProt: A0B8X1
Position
complement(1464261..1464941)
Genome map
AA seq 226 aa AA seqDB search
MRLKVKEGSEVPVSIISMDSCKRYLWISMERIPEERFPPCIRNMLHRASEEGSNRAGAVL
ASFLGQAGWSEGDALKLWKIFAERTGLSESLFRKWFARMNCPSCRTIKSEARGYPDLGLQ
GLSYCEPDERCRDISWPVAYSLDDPDWGWLKPLGRKNRVRVYNWITAREEELEVSDDLRG
EIEKILAEIGSEQQIFVTKTREGGRLRIRFLVRDSELRKSVLSDLL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaaggtgaaagagggctcggaggtaccggtctccataatttcgatggattca
tgcaagaggtatctgtggatatccatggagaggataccggaggagcggttcccgccgtgc
ataaggaacatgctccaccgcgcatctgaggagggcagcaacagggccggagctgttctc
gcctcatttctcggccaggcaggctggagcgagggtgatgccctgaagctctggaagatc
ttcgctgagaggaccggcctgagtgaatctcttttcaggaagtggttcgccaggatgaac
tgcccctcgtgccgcacgataaagagcgaggccaggggatacccggatctggggctacag
ggattgagctactgcgagcccgacgagcgatgcagagatatatcctggcctgtcgcatac
tctctcgacgatccagactggggctggctcaaacccctgggcaggaagaacagggtgcgc
gtctacaactggatcacggcccgcgaggaggagctggaggtatcggatgatctgaggggt
gagatcgagaagatcctcgcagagatcggatccgagcagcagatattcgtgaccaagacc
agggagggtgggaggctcagaatcaggtttctcgtgagggactcggagctgagaaagagc
gtcctctcagaccttctctga

DBGET integrated database retrieval system