KEGG   Methanosaeta thermophila: Mthe_1372Help
Entry
Mthe_1372         CDS       T00417                                 

Definition
(GenBank) Radical SAM domain protein
  KO
K04070  putative pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
mtp  Methanosaeta thermophila
Brite
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     Mthe_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: ABK15147
JGI: Mthe1372
UniProt: A0B8X3
Position
1466652..1467548
Genome map
AA seq 298 aa AA seqDB search
MAVYNRMPPEELQSRAEEAIRRLEHCEICPRRCGVNRIEGELGFCRTGRLAKVSSAGPHY
GEEPPLVGYHGSGTIFFAGCNLACVFCQNYEISQLDMGVEVTAERLAGIMMHLQLTGCHN
INLVTPTHVVPQILEALVIASEMGLSIPLVYNSGGYDSVDTLRLLDGIVDIYMPDAKYGS
DEMAMRYSNAPGYVGVMKAAIKEMHRQVGDLVIENGIAVRGLLVRHLVLPDNLAGTDEVV
RFISELSKNTYINIMDQYRPEYRADRYRELSRRITLSEYREALRLARAAGLSRGLEDI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtctacaaccgcatgcctccagaggagcttcagtcaagggctgaggaggcgatt
cgcaggctggagcactgcgagatatgccccaggagatgtggggtcaatcgcattgaggga
gagctggggttctgcaggacaggtcgcttggcgaaggtgagcagcgcgggcccgcactac
ggagaggagccgccgctcgtcggctaccacggctctggaaccatattcttcgccggctgc
aacctggcatgcgtcttctgtcagaactacgagataagtcagcttgatatgggggtagag
gtcaccgcagaacgcctcgcaggcataatgatgcatctccagctcacaggctgtcataac
atcaatctcgtcacaccgacacatgtcgtgccgcagatactcgaggcactggtcatcgca
agcgaaatgggcctgagcataccgctggtttacaacagcggcgggtatgattcggtggat
acgcttcgacttctcgatggcatcgtggacatctacatgccggatgcgaaatacggctcc
gacgagatggcaatgaggtactccaatgcccccggatatgtgggggtcatgaaagctgca
ataaaggagatgcaccggcaggtcggggatctggtcatcgagaacgggatcgcagtcaga
gggcttctcgtgcgccatctggtccttccagataacctggcaggcacagatgaggttgtg
aggttcatatcagagctctcgaagaacacgtacatcaacatcatggaccagtacaggccc
gagtacagagcagatcggtacagagagctctcgaggcgcataacgctgagcgaatacaga
gaggccctgcggcttgcaagggctgctggcctctcgaggggactggaggatatttaa

DBGET integrated database retrieval system