KEGG   Methanosaeta thermophila: Mthe_1385Help
Entry
Mthe_1385         CDS       T00417                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit E
  KO
K00581  
tetrahydromethanopterin S-methyltransferase subunit E [EC:2.1.1.86]
Organism
mtp  Methanosaeta thermophila
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mthe_1385
Enzymes [BR:mtp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mthe_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1479054..1479959)
Genome map
AA seq 301 aa AA seqDB search
MDALSMGLVAAMGALATVAGASEDIESDVGSQSNPNSQVQLAAQVGNPHRIYNKAISGEP
PANALWATTAAVVAYTLITKFAMPALFAIAVGASVAALFNGVFSTSAYFGRNASQRRFNQ
WIYLDIVRYTTPSIMAHAWITAFCITCIAYIQTQILMPHHPFPMPVIAMIWGIAVGAIGS
SVGDIHYGGEREFQWRIFGQGLNTMLSGQIVRKAEAGLRNSIDNAWFCAKLGGPFTGLAF
GLVVFLDSWRTTVFDPVTQSGLAIGMGLFFVILMNLYNYYVETSVRRKYGPYPGYKGDIP
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacgcattgagcatggggctcgtcgctgctatgggggcccttgcgaccgttgctgga
gccagcgaggatattgaatcggatgttggctcacagagcaatccaaactcgcaggtccag
cttgctgcacaggtcggaaacccccacaggatatacaacaaggccatctcaggcgagcca
ccggcgaacgccctttgggctacaaccgctgctgttgtggcttacacgctgataacaaag
ttcgcaatgcctgcgctcttcgcaatagccgtaggcgcgtcagttgcagcgctcttcaat
ggagtcttctcgaccagcgcttacttcggcaggaacgcaagccagcgcaggttcaatcag
tggatctatctggacatagtccgttacacgacaccatccataatggcacatgcatggata
acggcattctgcataacatgtatagcgtacatacagacacagattttgatgccacatcat
ccgttcccgatgcctgttatcgctatgatctggggaatagctgttggtgcgatcggttct
tctgtgggtgatattcattatggaggcgagcgtgagttccagtggagaatcttcggccag
ggtctcaacacgatgctctcgggccagattgtcaggaaggccgaggctgggttgaggaac
tccatcgacaacgcatggttctgtgccaagcttggaggtccgtttacaggtcttgcgttc
ggtctggtggtattcctggatagctggcgcacaacagtcttcgacccggtgacacagtcc
ggtctggcaataggcatgggactgttctttgtgatactgatgaatctctacaactactat
gttgagacctcggtgagaagaaagtatggtccgtatccagggtacaagggggatattcca
gcatga

DBGET integrated database retrieval system