KEGG   Methanosaeta thermophila: Mthe_1395Help
Entry
Mthe_1395         CDS       T00417                                 

Definition
(GenBank) transposase, IS605 OrfB family
  KO
K07496  
putative transposase
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1492254..1492955
Genome map
AA seq 233 aa AA seqDB search
MSHCLRSEVCEVGCLKSFVVDTGNNSVENPGFAEKVSTKVKNIHRRLSRAEKGSKNRQTL
IDKLNKVNYKIKNQRNDFLHKLSRHYVNNYKIICVEDLDVKRMKENGHNKSMHRDIHDAF
WSRFMFMLSYEAECAGRRLIEVNPMNTTQRCSACRSIVEKELSDRVHECPHCGFSCDIDC
NASMHIAGMEQPVAPMESTSTSHFCDASVGYDVGSPALQGGAVHTTYEAYPVW
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagccattgcctgagatcggaggtgtgtgaggttggatgtctgaaatcatttgttgtg
gacacaggtaacaactctgtggagaatccagggtttgcagagaaggttagcactaaagtt
aagaacatccataggagattatccagagctgagaaaggctccaagaatcgtcagacactc
atagataagctgaacaaggtaaattataaaatcaagaatcagagaaacgattttctccac
aagctctcaagacactatgtcaacaactataagataatctgtgttgaagatctggatgtc
aaacgtatgaaggagaatggccataacaaaagcatgcatcgtgacatccatgatgcattc
tggtccaggttcatgttcatgctctcgtacgaggctgaatgtgctggtcgaaggctgatc
gaggtgaatcccatgaacaccactcaaaggtgttctgcctgtagaagcattgtagaaaaa
gagttatcggacagggttcatgagtgtcctcactgtggattctcatgtgatatagactgc
aatgcttccatgcacatcgcagggatggaacagcccgtagcgcccatggagtcaacttct
acatcacatttctgtgatgcaagtgttggctatgatgtgggaagccctgcccttcagggt
ggggcagttcatacaacgtatgaggcataccctgtgtggtag

DBGET integrated database retrieval system