KEGG   Methanosaeta thermophila: Mthe_1396Help
Entry
Mthe_1396         CDS       T00417                                 

Definition
(GenBank) protein of unknown function DUF125, transmembrane
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1492959..1493552
Genome map
AA seq 197 aa AA seqDB search
MVIPRIELYRRYLKASGALEIARRLFVMNAFDGVLTIMGVVLGAYLSGVQDSGFVITAGM
GGSIAMGISGMSGAYMAERAERMRDIKKLESAMLRDLNGTHVVRAFRTASVVVALVDGIS
PAIAALLLILPFFMVPMISIGVAAMLSLALGLVVLFFLGLFLARISEEVALISGLKMMLV
GVLTILIVSLAVSPDAL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcccgcgcatagaactctacagaaggtacctcaaggccagcggcgcgctggag
attgccaggcgtctcttcgttatgaacgcatttgatggcgttctgacgatcatgggtgtg
gttcttggggcatatctatcaggtgtccaggattctggatttgtgataaccgcaggaatg
ggcggaagcatagcgatgggcatatcgggaatgagcggagcttacatggcggagagggct
gaaaggatgagggatatcaagaagctggaatctgcgatgctcagagatctcaatggcact
catgttgtcagggcatttagaactgcgagcgttgtggttgcgctcgtcgacggaatcagc
ccggcgatcgcagcccttctcctgatcttgccgttcttcatggtcccgatgataagcata
ggcgttgcggccatgctctcgcttgctctcgggctggtggtgctcttcttcctcgggctc
ttcctggccaggataagcgaggaggtggcactgataagcggtctgaagatgatgcttgtc
ggcgttctgaccatactgatcgtgagccttgcggtctctccggatgcgctgtga

DBGET integrated database retrieval system